DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and NimB5

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster


Alignment Length:189 Identity:46/189 - (24%)
Similarity:70/189 - (37%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCSSDAQCAQF------ERGRCVDMAC-------ICTARGSGERVPCTPLEERLKLTNII--GGA 77
            ||....:|..:      :.|.|| .||       .|...||.:..|...|:|..:....|  .|.
  Fly   155 SCKIPGECECYDGFVRNDNGDCV-FACPLGCQNGQCYLDGSCQCDPGYKLDETRRFCRPICSSGC 218

  Fly    78 CPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVP---VGGSCEFQQQCQRADRFSSCIGNQ 139
            ...|..|.   |..:.|.||:|:..:||  .|.|...|   :||.|:              ..||
  Fly   219 GSSPRHNC---TEPEICGCSKGYQLTDD--GCQPVCEPDCGIGGLCK--------------DNNQ 264

  Fly   140 CLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCI 198
            |.|...:...:|.|    |:.|.:     .|...:|::: .||.|...:.::...|.|:
  Fly   265 CDCAPGYNLRDGVC----QADCYQ-----KCNNGVCVSR-NRCLCDPGYTYHEQSTMCV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 16/59 (27%)
NimB5NP_001188802.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.