DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Ccbe1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:204 Identity:40/204 - (19%)
Similarity:70/204 - (34%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSC-----------EFQQQCQRADRFSSCIG 137
            |.|..|:: .|..|.|.:::..|::|......|.|.|           ..:|||  .|.|...: 
Mouse    51 NKITTTKY-PCLKSSGELTTCFRKKCCKGYKFVLGQCIPEDYDICAQAPCEQQC--TDNFGRVL- 111

  Fly   138 NQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASIC------LTKTKRCGCSKNFVHNHNMTK 196
              |.|...:.:...|.....:..||:..:|.:...::|      ...:..|.|.:.::...:...
Mouse   112 --CTCYPGYRYDRERHQKRERPYCLDIDECATSNTTLCAHICINTMGSYHCECREGYILEDDGRT 174

  Fly   197 CIKGSAYGDTCEHSSPCKLNLGADGRCLDHLCVCRSTHYPKRV--------------ANEVAKDE 247
            |.:|..|.:...|....:..:.| |.|   ...|:.....|:.              |.|:.|..
Mouse   175 CTRGDKYPNDTGHEEKSENEVKA-GTC---CATCKEFSQMKQTVLQLKQKMALLPNNAAELGKYV 235

  Fly   248 NDDLDAVNN 256
            |.|....:|
Mouse   236 NGDKVLASN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 14/67 (21%)
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 4/40 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.