DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and NimA

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:284 Identity:58/284 - (20%)
Similarity:86/284 - (30%) Gaps:108/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QCAQFE-------------RGRCVDMACICTARG-----SGERVPCTPLEERLKLTNIIGGAC-- 78
            :||.|:             :.|.|...|    :|     |..:..|.|         |..|.|  
  Fly    86 RCATFKTEMREVMRVQKLNKTRTVRFCC----QGYEGNLSDSQATCKP---------ICRGGCGR 137

  Fly    79 -PCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLC 142
             .|.||:.        |.|.||:               :|..|  .|:|.. ||:.....|.|.|
  Fly   138 GSCVMPDI--------CSCEEGY---------------IGKHC--TQRCDH-DRWGLDCKNLCQC 176

  Fly   143 LNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTC 207
            .|                          ||: |..|:..|.|...:........|.:|: ||..|
  Fly   177 QN--------------------------GAA-CDNKSGLCHCIAGWTGQFCELPCPQGT-YGIMC 213

  Fly   208 EHS-----SPCKLNLGADGRCLDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVP 267
            ..:     .||....||        |:.:.......|::.:.:..|..|:.:..:.|.|....:|
  Fly   214 RKACDCDEKPCNPQTGA--------CIQQDQPLQLNVSHVIVETVNSTLEKMGIIPRPTTPVPLP 270

  Fly   268 FGALCRNDSECRMQPMDQENATAS 291
            ...:.:       ||...|||..|
  Fly   271 EVIVIK-------QPTSNENAQHS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 13/56 (23%)
NimANP_001285918.1 EMI 52..116 CDD:284877 6/33 (18%)
EGF_2 170..200 CDD:285248 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.