DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Dkk2

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:244 Identity:55/244 - (22%)
Similarity:70/244 - (28%) Gaps:109/244 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCP---MPNAIC--- 87
            ||||.:|   |.||    .|....:||...:.|...::|...    .|.| ||   ..|.||   
  Rat    78 CSSDKEC---EVGR----YCHSPHQGSSACMVCRRKKKRCHR----DGMC-CPGTRCNNGICIPV 130

  Fly    88 -------H------TR---------------WQQC---HCSEGHVSSDDRRRCLPAVVPVGGSCE 121
                   |      ||               ||..   |....|:...:...||           
  Rat   131 TESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEGDPCL----------- 184

  Fly   122 FQQQCQRADRFSSCIGNQCLCLNQF-------EFHEGRCLSVLQSSCLEDKDCGSCGASICLTKT 179
                     |.|.||...| |...|       ..|:|..       |.:.:..||.|..|    .
  Rat   185 ---------RSSDCIDGFC-CARHFWTKICKPVLHQGEV-------CTKQRKKGSHGLEI----F 228

  Fly   180 KRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDHLC 228
            :||.|:|..     ..|..|.:.|      ||..:|          |:|
  Rat   229 QRCDCAKGL-----SCKVWKDATY------SSKARL----------HVC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 12/63 (19%)
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.