DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Pear1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001128431.1 Gene:Pear1 / 295293 RGDID:1305653 Length:1033 Species:Rattus norvegicus


Alignment Length:404 Identity:94/404 - (23%)
Similarity:121/404 - (29%) Gaps:148/404 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGAC--PC---PMPNAICH 88
            |:....||...|....:.||:|....:|:|  ||   |||......|.:|  ||   |..:..||
  Rat   313 CAETCDCAPGARCFPANGACLCEHGFTGDR--CT---ERLCPDGRYGLSCQDPCTCDPEHSLSCH 372

  Fly    89 TR---------WQQCHCSE-------------------GHVSSDDRR--RCLPAVV--------- 114
            ..         |...||:|                   |.|...|..  ||.|...         
  Rat   373 PMHGECSCQPGWAGLHCNESCPQDTHGAGCQEHCLCLHGGVCLADSGLCRCAPGYTGPHCANLCP 437

  Fly   115 --PVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGAS---- 173
              ..|.:|.....|:.|...|...|. |:|...::  .|.| ||   .|.......||.||    
  Rat   438 PNTYGINCSSHCSCENAIACSPVDGT-CICKEGWQ--RGNC-SV---PCPPGTWGFSCNASCQCA 495

  Fly   174 ---ICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGD------TCEHS-------SPCKLNLGADG- 221
               :|..:|..|.|:..:...|....|.||. :|:      .|:||       ..|:...|..| 
  Rat   496 HEGVCSPQTGACTCTPGWRGVHCQLPCPKGQ-FGEGCASVCDCDHSDGCDPVHGHCRCQAGWMGT 559

  Fly   222 RCLDHL--------------CVCRS--THYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFG- 269
            ||  ||              |.|::  |..|          ||.:..........:|....|.| 
  Rat   560 RC--HLPCPEGFWGANCSNACTCKNGGTCVP----------ENGNCVCAPGFRGPSCQRPCPPGR 612

  Fly   270 -------ALCRNDSECRMQPMDQENATASI---------------GHPMVCNWG-----ECSC-- 305
                   ..|.|.|.|  .|.|   .|.|.               ||     ||     .|.|  
  Rat   613 YGKRCVPCKCNNHSSC--HPSD---GTCSCLAGWTGPDCSESCPPGH-----WGLKCSQPCQCHH 667

  Fly   306 SKTHRLEDNKCVFV 319
            ..|...:|..||.:
  Rat   668 GATCHPQDGSCVCI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 17/88 (19%)
Pear1NP_001128431.1 EMI 25..93 CDD:284877
EGF_CA 535..580 CDD:304395 11/46 (24%)
Laminin_EGF 620..665 CDD:278482 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.