DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Dkk1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:226 Identity:42/226 - (18%)
Similarity:72/226 - (31%) Gaps:85/226 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGS---C-----------GASICLTKTKRCGCSKN 187
            ||:...|:.::.:          .|.||::||:   |           |..|||...||      
  Rat    72 GNKYQTLDNYQPY----------PCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKR------ 120

  Fly   188 FVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCL--DHLCVCRSTHYPK-RVANEVAKDEND 249
                  ..:|::         |:..|..|...:|.|:  ||      :|.|: .:...:.::..:
  Rat   121 ------RKRCMR---------HAMCCPGNYCKNGICMPSDH------SHLPRGEIEEGIIENLGN 164

  Fly   250 DLDAVNNLERITCAPIVPF------GALCRNDSECRMQPMDQENATASIGHPMV----------- 297
            |..|.:...|.|......:      |::|...|:|........:..:.|..|::           
  Rat   165 DHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRR 229

  Fly   298 -----------CNWGE---CSCSKTHRLEDN 314
                       |..||   |...|.|....|
  Rat   230 KGSHGLEIFQRCYCGEGLACRIQKDHHQTSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 3/15 (20%)
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.