Sequence 1: | NP_572948.1 | Gene: | CG11674 / 32374 | FlyBaseID: | FBgn0030551 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055236.1 | Gene: | DKK2 / 27123 | HGNCID: | 2892 | Length: | 259 | Species: | Homo sapiens |
Alignment Length: | 244 | Identity: | 55/244 - (22%) |
---|---|---|---|
Similarity: | 70/244 - (28%) | Gaps: | 109/244 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 CSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCPMP---NAIC--- 87
Fly 88 -------H------TR---------------WQQC---HCSEGHVSSDDRRRCLPAVVPVGGSCE 121
Fly 122 FQQQCQRADRFSSCIGNQCLCLNQF-------EFHEGRCLSVLQSSCLEDKDCGSCGASICLTKT 179
Fly 180 KRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDHLC 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11674 | NP_572948.1 | EB | 96..153 | CDD:279949 | 12/63 (19%) |
DKK2 | NP_055236.1 | Dickkopf_N | 78..128 | CDD:282549 | 19/61 (31%) |
DKK-type Cys-1 | 78..127 | 18/60 (30%) | |||
DKK-type Cys-2 | 183..256 | 27/125 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |