DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Dkk4

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:194 Identity:42/194 - (21%)
Similarity:69/194 - (35%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CSEGH---VSSDDRRRCLPAVVPVGGSC-EFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSV 156
            ||||.   ...|:|..|        .:| ..:::|||:  ...|.|.  :|:|..      |.:|
Mouse    47 CSEGKFCLAFHDERSFC--------ATCRRVRRRCQRS--AVCCPGT--VCVNDV------CTAV 93

  Fly   157 LQSSCLEDKDC-GSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGS--AYGDTCEHSSPCKLNLG 218
            ..:..:.|::. |..||  ....|.:....:|.......||..:.|  ..|::|..:|.|...| 
Mouse    94 EDTRPVMDRNTDGQDGA--YAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGL- 155

  Fly   219 ADGRCLDHLCVCRSTHYPKRVANEVAKD--------ENDDLDAVNNLERITCAPIVPFGALCRN 274
                       |.:.|:..::...|.::        ..|...|....:|..|.|    |..||:
Mouse   156 -----------CCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGP----GLTCRS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 15/60 (25%)
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 15/61 (25%)
DKK-type Cys-1 41..90 15/60 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 9/43 (21%)
DKK-type Cys-2 145..218 15/76 (20%)
Prokineticin <145..202 CDD:148298 13/72 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.