DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and STAB1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:488 Identity:100/488 - (20%)
Similarity:140/488 - (28%) Gaps:241/488 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLAGFLATG-------RAEDLLE--LSCSSDAQCAQ-FE-----RGRCVDMACICTARGSGE- 57
            |:.|:|.|..|       .||.|.|  ::|:...:|.| |:     |..||..:....:||... 
Human  1246 LIGLSGVLTVGSSRCLHSHAEALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYT 1310

  Fly    58 -----RVP-CTPLEERLKLTNIIGGAC-PCPMP-NAIC--HTRWQ-------QCHCSEG-HVSSD 104
                 :|| |.|        ...|..| |||.. ..:|  |.:.|       :|||.|| |    
Human  1311 CAKKIQVPDCCP--------GFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFH---- 1363

  Fly   105 DRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQ----------- 158
                        |.:||.   |:......:|.| .|.|.:      |.|...||           
Human  1364 ------------GTACEV---CELGRYGPNCTG-VCDCAH------GLCQEGLQGDGSCVCNVGW 1406

  Fly   159 ---------------------SSCLEDKDCGSCGASIC--------------------------- 175
                                 ::|::|    |.|||.|                           
Human  1407 QGLRCDQKITSPQCPRKCDPNANCVQD----SAGASTCACAAGYSGNGIFCSEVDPCAHGHGGCS 1467

  Fly   176 ----LTKT----KRCGCSKNF--------------VHN---HNMTKCI-----------KGSAYG 204
                .||.    :.|.|...:              :|:   |...:||           :....|
Human  1468 PHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCREGYSG 1532

  Fly   205 D---TCEHSSPCKLNLG-----------ADGRCLDHLCVCRSTH-------YPKRVANEVAKDEN 248
            |   |||...||..|.|           .||:   ..|.|.:.|       ...||..|:.:|::
Human  1533 DGIRTCELLDPCSKNNGGCSPYATCKSTGDGQ---RTCTCDTAHTVGDGLTCRARVGLELLRDKH 1594

  Fly   249 DDLDAVNNLE-----RI-------TCAP--------------IVPFGALCRNDSE---------- 277
            ....::..||     |:       .|.|              .||...|..|.|:          
Human  1595 ASFFSLRLLEIHGRLRLLPFHSCCCCLPQEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAHR 1659

  Fly   278 ----------CRM----QPMDQENATASIGHPM 296
                      ||.    ..::|..|||..|||:
Human  1660 QLVFRYHVVGCRRLRSEDLLEQGYATALSGHPL 1692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 13/57 (23%)
STAB1XP_016861487.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.