DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and DKK1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:198 Identity:35/198 - (17%)
Similarity:59/198 - (29%) Gaps:70/198 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 CLEDKDCGS------------CGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPC 213
            |.||::||:            .|..|||...||            ..:|::         |:..|
Human    85 CAEDEECGTDEYCASPTRGGDAGVQICLACRKR------------RKRCMR---------HAMCC 128

  Fly   214 KLNLGADGRCLDHLCVCR-STHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPF------GAL 271
            ..|.     |.:.:||.. ..|:...:...:.:...:|...::...|.|......:      |::
Human   129 PGNY-----CKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSV 188

  Fly   272 CRNDSECRMQPMDQENATASIGHPMV----------------------CNWGE---CSCSKTHRL 311
            |...|:|........:..:.|..|::                      |..||   |...|.|..
Human   189 CLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQ 253

  Fly   312 EDN 314
            ..|
Human   254 ASN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 16/79 (20%)
DKK-type Cys-1 85..138 16/78 (21%)
DKK-type Cys-2 189..263 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.