DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and MEGF6

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_011539187.1 Gene:MEGF6 / 1953 HGNCID:3232 Length:1603 Species:Homo sapiens


Alignment Length:339 Identity:78/339 - (23%)
Similarity:98/339 - (28%) Gaps:116/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CSSDAQCAQFERGRC--VDMACICTARGSGER-----------------------VPCTPLEERL 68
            ||.:.||.|.....|  .|.:|.|.|...|||                       |.|.      
Human   712 CSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACD------ 770

  Fly    69 KLTNIIGGACP-----------CPM-------------PNAICHTRWQQCHCSEGHVSSDDRRRC 109
            .::...|..||           ||:             ..|.||....||.|..|....|....|
Human   771 SVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSCGGAPCHGVTGQCRCPPGRTGEDCEADC 835

  Fly   110 LPAVVPVG----GSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQS-----SCLEDK 165
                 |.|    |..|....||.|.|.....| .||||..|.  ..||..|..:     ||....
Human   836 -----PEGRWGLGCQEICPACQHAARCDPETG-ACLCLPGFV--GSRCQDVCPAGWYGPSCQTRC 892

  Fly   166 DCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRC--LDHLC 228
            .|.:.|.  |...|..|.|:..:........|..|. :|..|.|  ||..:.| .|.|  :..||
Human   893 SCANDGH--CHPATGHCSCAPGWTGFSCQRACDTGH-WGPDCSH--PCNCSAG-HGSCDAISGLC 951

  Fly   229 VCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFGALCRNDSECRMQPMDQENATASIG 293
            :|.:.:...|...:                    .|...||..|....:|:              
Human   952 LCEAGYVGPRCEQQ--------------------CPQGHFGPGCEQRCQCQ-------------- 982

  Fly   294 HPMVCNW--GECSC 305
            |...|:.  |.|:|
Human   983 HGAACDHVSGACTC 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 18/60 (30%)
MEGF6XP_011539187.1 EMI 108..176 CDD:284877
vWFA <215..261 CDD:294047
FXa_inhibition 268..304 CDD:291342
vWFA <342..384 CDD:294047
FXa_inhibition 397..432 CDD:291342
vWFA <432..469 CDD:294047
vWFA <472..511 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.