DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and dsl-6

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_502148.2 Gene:dsl-6 / 178063 WormBaseID:WBGene00001108 Length:303 Species:Caenorhabditis elegans


Alignment Length:98 Identity:24/98 - (24%)
Similarity:35/98 - (35%) Gaps:33/98 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FQQQCQRADRFSSCI-----GNQC------LCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASIC 175
            |.::|   |.|...|     |.:|      .|||.|.  ...|:.::...   |..|.:.|..:.
 Worm   126 FGEKC---DVFCDNIEQRLHGKRCNYRGVPSCLNMFT--GAGCMKMITPM---DCSCKNNGKCVD 182

  Fly   176 LTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCE 208
            ..:|..|.|::.|              .|||||
 Worm   183 SAETPICECTRGF--------------KGDTCE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 11/41 (27%)
dsl-6NP_502148.2 DSL 101..163 CDD:128366 11/41 (27%)
EGF_CA <174..201 CDD:238011 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.