DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and pqn-25

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_741140.1 Gene:pqn-25 / 175759 WormBaseID:WBGene00004114 Length:672 Species:Caenorhabditis elegans


Alignment Length:393 Identity:82/393 - (20%)
Similarity:134/393 - (34%) Gaps:140/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSCSSDAQCAQFERG-RCVDMAC-------ICTARG-SGERVPCTPLEERLKLTNIIGGAC---- 78
            ::||::.|||.   | .|.:.||       .|::.| :|.....|.:..:...:..||.||    
 Worm   124 VTCSTNTQCAS---GYTCNNGACCPNTNSNTCSSNGNNGCLAGQTMVNGQCYNSVNIGSACQSTQ 185

  Fly    79 ------PCPMPNAICHTRW----QQC------HCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQ 127
                  .|......|::.:    |||      :|..|.||.:.  :|:....| |.:|:...|| 
 Worm   186 QCLGGSQCQNNICQCYSGYVNVNQQCVISNGLNCQLGTVSYNS--QCITLASP-GQNCQTSSQC- 246

  Fly   128 RADRFSSCIGNQCLCLNQFEFHEGRC---------------------LSVLQSSCLEDKDCGSCG 171
             .|. |.|:...|.|.|.:....|.|                     ||::..:|:.::.|  .|
 Worm   247 -IDN-SVCMNQMCTCNNNYRLVYGYCVPITSSICQQTQTLVNNQCVLLSIVGETCIANQQC--VG 307

  Fly   172 ASICLTKTKRC-----------------GCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGA 219
            .::|.:.|.:|                 .|:.|.|..:.|  |......|.:|..|..| ||   
 Worm   308 GAMCNSGTCQCTNGATAMYGYCISSSSSSCNSNQVSINGM--CYNTVQVGGSCSFSQQC-LN--- 366

  Fly   220 DGRCLDHLCV-------CRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFGALCRNDSE 277
            :..|.:::||       |.:        |:|         .::|    .|...|..|:.|....:
 Worm   367 NAVCTNNICVSTFCSVSCST--------NQV---------CISN----QCYNYVSIGSQCVGSQQ 410

  Fly   278 CRMQPMDQENATASIGHPMVCNWGECSCSK----------THRLEDNKC----VFVENSATNYQL 328
            |    :......:||          |.|.:          .:...:|:|    |.:.|...|...
 Worm   411 C----LSNSQCISSI----------CQCPQGTQQSNGVCTGNNNNNNQCQPNQVLINNQCYNTVS 461

  Fly   329 RGF 331
            .||
 Worm   462 IGF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 17/56 (30%)
pqn-25NP_741140.1 EB 160..211 CDD:279949 8/50 (16%)
EB 219..270 CDD:279949 17/56 (30%)
EB 278..329 CDD:279949 8/52 (15%)
EB 341..>376 CDD:279949 10/40 (25%)
EB 384..435 CDD:279949 13/85 (15%)
EB 450..496 CDD:279949 5/15 (33%)
EB 504..555 CDD:279949
EB 563..614 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.