DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and D1044.7

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_498177.1 Gene:D1044.7 / 175758 WormBaseID:WBGene00017032 Length:400 Species:Caenorhabditis elegans


Alignment Length:347 Identity:76/347 - (21%)
Similarity:119/347 - (34%) Gaps:114/347 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSCSSDAQCAQFERGR-CVDMAC-------ICTARGS-------------------GERVPCTPL 64
            ::|.:::|||.   |. |.:.||       .|:..|:                   |:|  |...
 Worm    91 VTCFTNSQCAS---GYICSNGACCPNTNSNTCSTTGTPCFTGQISVGGQCFNSVNIGDR--CQRS 150

  Fly    65 EERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRA 129
            |:.|..:......|.|  ||...:.. |:|.|..|.|..:.  :|:....| |.:|:...||  .
 Worm   151 EQCLGGSQCQNNLCQC--PNGFANVN-QKCACQLGTVLFNS--QCITLASP-GQNCQISSQC--I 207

  Fly   130 DRFSSCIGNQCLCLNQFEFHEGRC---------------------LSVLQSSCLEDKDCGSCGAS 173
            |. |.|....|.|...:....|.|                     ||::..:|:.::.|  .|.:
 Worm   208 DN-SVCNNQMCSCNGNYRLVFGYCVPFTNSKCQQTQTLVNNQCVLLSIVGETCIANQQC--VGGA 269

  Fly   174 ICLTKTKRC-------------------GCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGA 219
            :|.:.|.||                   .|:.|.|:.:.  :|......|..|:.:..|   || 
 Worm   270 MCNSGTCRCTNGATAMYGYCISSQSTVNPCNSNQVYYNG--QCYNTVNIGFQCQITQQC---LG- 328

  Fly   220 DGRCLDHLCVCRSTHYPK--------RVANEVAKDENDDLDAVNNLERITCAPIVPFGALCRNDS 276
            :.:|.:..|.|.|.. |.        ..:|..:..:...||  ||.:.|.|...|     |.|.|
 Worm   329 NSQCQNSFCQCTSGS-PNNGICPTSPNTSNLCSSGQTVQLD--NNNQPINCLVTV-----CPNTS 385

  Fly   277 ECRMQPMDQENATASIGHPMVC 298
            .|:.         :|.|...||
 Worm   386 FCQY---------SSSGQRYVC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 15/56 (27%)
D1044.7NP_498177.1 EB 126..177 CDD:279949 10/55 (18%)
EB 179..230 CDD:279949 15/56 (27%)
EB 238..289 CDD:279949 9/52 (17%)
EB 299..349 CDD:279949 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.