DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and F07H5.8

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_495874.3 Gene:F07H5.8 / 174407 WormBaseID:WBGene00008559 Length:835 Species:Caenorhabditis elegans


Alignment Length:388 Identity:76/388 - (19%)
Similarity:130/388 - (33%) Gaps:138/388 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCPMPNAICHTRWQ-- 92
            :|..||....:..| |..||.|.:...:::.....::|  ..|.: .||......:...:::|  
 Worm   479 TSSPQCIPQCQPSC-DQQCIQTYKIQVQQMNSQQKQQR--QYNCV-PACQPTCEQSCIQSQYQVT 539

  Fly    93 -QCHCSEGHVSSDDRRRCLPA-------------VVPVGGSCEFQ------QQC-QRADRFS--- 133
             |...|:|:..:.....|.||             .||:..:|..|      |:| |:|..::   
 Worm   540 IQQSYSKGNQGNSCPSACQPACEPLCVQQITVQTTVPITKTCVPQCQPACTQECVQQATTYTISI 604

  Fly   134 -------SCIGN-------QCL-----------------CLNQFEFHEGRCLSVLQSSCLE---- 163
                   ||...       ||:                 |       :.:|....|.||:|    
 Worm   605 PMTTAAPSCAPQCQPACDPQCISFTLKLPVMTTPPPTPSC-------QPQCQPACQPSCMETYTF 662

  Fly   164 --------DKDCGSCGASICLTKTKRCGCSKNF--------VHNHNMTKCIKGSAYGDTCEHSSP 212
                    .|.|......:|.:|     |.:|:        ..|:.|..|.:      :|: :|.
 Worm   663 TIPMNDQSSKQCAPACQPVCDSK-----CIQNYQFEIVIPQADNNCMPACTQ------SCQ-TSC 715

  Fly   213 CKLNLGADGRCLDHLCV--CRSTHYPKRVANEVAKDEND---DLDAVNNL---ERITCAPIVPFG 269
            .:.|..:..:| ...|.  |||:      ..|:.|:..:   .|:.|...   |.:||||     
 Worm   716 VQQNSQSVPQC-STACTDSCRSS------CVEIVKESAEPTFKLEIVLKKPMEETVTCAP----- 768

  Fly   270 ALCRND--SECRMQPMD-------------QENATASIGHPMVCNWGECSCSKTHRL-EDNKC 316
             .|.|.  .:|:.|.:.             |:|....: .|...:..:|:||....| .:|:|
 Worm   769 -QCANQCVDQCKTQLLTQIEFCLPACQNACQQNCPLQV-EPCAMSGSQCNCSTGFSLCGNNQC 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 18/110 (16%)
F07H5.8NP_495874.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.