DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Dkk1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:220 Identity:45/220 - (20%)
Similarity:79/220 - (35%) Gaps:66/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGS---C-----------GASICLTKTKRCGCSKN 187
            ||:...|:.::.:          .|.||::|||   |           |..|||...||      
Mouse    72 GNKYQTLDNYQPY----------PCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKR------ 120

  Fly   188 FVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCL--DHLCVCRSTHYPK-RVANEVAKDEND 249
                  ..:|::         |:..|..|...:|.|:  ||      :|:|: .:...:.::..:
Mouse   121 ------RKRCMR---------HAMCCPGNYCKNGICMPSDH------SHFPRGEIEESIIENLGN 164

  Fly   250 DLDAV--NNLERITCAPIVPF------GALCRNDSECRMQPMDQENATASIGHPMVCNWGECSCS 306
            |.:|.  :...|.|......:      |::|...|:|........:..:.|..|::.....|:..
Mouse   165 DHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKH 229

  Fly   307 K---THRLE-DNKCVFVENSATNYQ 327
            |   :|.|| ..:|...|..|...|
Mouse   230 KRKGSHGLEIFQRCYCGEGLACRIQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 3/15 (20%)
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 18/76 (24%)
DKK-type Cys-1 86..141 18/75 (24%)
DKK-type Cys-2 195..269 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.