DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and megf11

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_002938407.3 Gene:megf11 / 100490321 XenbaseID:XB-GENE-6045392 Length:1053 Species:Xenopus tropicalis


Alignment Length:405 Identity:92/405 - (22%)
Similarity:124/405 - (30%) Gaps:120/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CSSDAQCAQFERGRCVDMACICTARGSGERVP--CTPLEERLKLTNIIGGACP--CPMPN-AICH 88
            ||:..||........:..||:|:....|.|..  |.|        ...|.||.  |...| |.|.
 Frog   148 CSNRCQCQNEALCNPITGACVCSDGYRGWRCEDWCDP--------GTYGKACQLRCQCQNGATCD 204

  Fly    89 TRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQR------------------------- 128
            .|..:|||:.|:..:.....|.|.  ..|..||.:..||.                         
 Frog   205 HRTGECHCAPGYTGAFCEELCPPG--SHGALCELRCPCQNGGVCHHVTGDCSCPAGWTGTVCAQP 267

  Fly   129 --ADRFSSCIGNQCLCLN--QFEFHEGRC---LSVLQSSCLEDKDCGSCGASICLTKTKRCGCSK 186
              :.||......:|.|.|  |.:...|||   .......|.|:...|:.|.. |   .:||.|..
 Frog   268 CPSGRFGVNCSQECQCHNGGQCDPLSGRCQCAAGYTGERCQEECPVGTYGFQ-C---AERCDCQN 328

  Fly   187 NFVHNHNMTKCI-----KG----------SAYGDTCEHSSPCKLNLGADGRCLDHLCVCRS---- 232
            .....|....|:     ||          ..||..|..:.||.|........|...|.||:    
 Frog   329 GAKCYHINGACLCEPGFKGILCEERVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSG 393

  Fly   233 ---------THYPKRVANEVAKDENDDLDAVNNLERITCAP-------IVP-----FGA------ 270
                     ..|.:......:.....|.|::..  |..|||       ..|     |||      
 Frog   394 LYCEEPCRPGFYGEGCQQLCSCHNGADCDSMTG--RCICAPGYTGQDCSAPCATGTFGADCLSVC 456

  Fly   271 LCRNDSECRMQPMDQ----ENATASIGHPMVCN---WG-----ECSCSKTHRLEDNKCVFVENSA 323
            .|:||:.|  .|:|.    ......:...:.|:   ||     .|.|     |.|..|..::.|.
 Frog   457 NCQNDAAC--SPVDGLCVCREGWQGLDCSIPCSSGTWGLNCNQSCLC-----LNDASCSPMDGSC 514

  Fly   324 TNYQLRGFVAFLCIQ 338
            |  ...|::..||.|
 Frog   515 T--CAPGWIGELCDQ 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 16/85 (19%)
megf11XP_002938407.3 EMI 32..99 CDD:400092
exchanger_TraA <94..>311 CDD:411343 41/172 (24%)
EGF_CA 759..804 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.