DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and si:ch211-221n20.8

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_021324390.1 Gene:si:ch211-221n20.8 / 100034409 ZFINID:ZDB-GENE-041014-220 Length:737 Species:Danio rerio


Alignment Length:393 Identity:88/393 - (22%)
Similarity:128/393 - (32%) Gaps:125/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AGFLATGRAEDLLEL-SC-SSDAQCAQFERGRCVDMA----CICTARGSGERV---PCTPLEERL 68
            ||:..|....:..:: .| ||:.:|.|    .|.:.|    |.| .||....:   .|..::| .
Zfish   298 AGYTITADLHNCTDVDECVSSNDRCEQ----TCTNTAGSFLCSC-RRGFQLHIDGHSCVDIDE-C 356

  Fly    69 KL---------TNIIGG-ACPCPMP------NAIC-------------------------HTRWQ 92
            ||         ||..|| .|.||.|      |..|                         |    
Zfish   357 KLQNGGCSHECTNTEGGHQCHCPFPLLLDLRNTTCVNVTSCALRNGGCDHICSLGAESRIH---- 417

  Fly    93 QCHCSEGHVSSDDRRRCLPA--VVPVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEF---HEGR 152
             |.|..|...|.|:|.|:..  .|.|.|.||  |.|     .:...|..|.|...||.   |..:
Zfish   418 -CSCRAGWELSADQRTCIDVDECVSVNGGCE--QVC-----VNHAGGFNCSCRAGFELRKDHPTK 474

  Fly   153 CLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCE--------- 208
            |..:...:|.....|.:.....|.......|||         ..|....|:|.:|.         
Zfish   475 CQPLCDPACQNSGVCVAPNTCDCPAGYPGAGCS---------AMCSPPCAHGGSCMRWNVCLCSP 530

  Fly   209 -------HSSPCKLNLGADGRCL-DHLCVCRSTHY-PKRVANE-----------VAKDENDDLD- 252
                   |::.|:|.....|||: .:.|.|.|.:. |:.:..:           ||.:....|| 
Zfish   531 GWTGEGCHTAVCELPCANGGRCIAPNTCQCPSDYSGPQCLTPQCSPPCVNGGRCVAINTCSCLDG 595

  Fly   253 ---AVNNLERITCAPIVPFGALCRNDSECR-MQPMDQENATASIGHPMV--CNWG-------ECS 304
               |...:|.:.|.|....|.:|...:.|: ::....::...::..|.|  |..|       .|.
Zfish   596 WRGARCQIEPVRCVPACNNGGVCVGLNRCQCVEGYTGKHCETALVTPCVPPCQHGAVCAPLNSCV 660

  Fly   305 CSK 307
            |.|
Zfish   661 CPK 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 19/61 (31%)
si:ch211-221n20.8XP_021324390.1 EGF_CA 57..>90 CDD:214542
cEGF 126..149 CDD:315355
EGF_CA 146..184 CDD:214542
EGF_CA 188..227 CDD:311536
EGF_3 233..268 CDD:315598
vWFA <268..305 CDD:320736 3/6 (50%)
vWFA <309..347 CDD:320736 11/42 (26%)
cEGF 332..355 CDD:315355 5/23 (22%)
FXa_inhibition 356..391 CDD:317114 11/34 (32%)
FXa_inhibition 397..433 CDD:317114 7/40 (18%)
vWFA <433..470 CDD:320736 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.