DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0007 and Zcchc17

DIOPT Version :9

Sequence 1:NP_572947.1 Gene:l(1)G0007 / 32373 FlyBaseID:FBgn0026713 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:164 Identity:33/164 - (20%)
Similarity:65/164 - (39%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VPQGSMLGLD--KLAAKRRAEKERSERLISFKDSEFDDTGGGSSTPQA------NASGASSEFA- 97
            |.||:...||  .:..::...:.||          |.|..|...|.:|      ...|....|| 
Mouse    90 VNQGTGKDLDPNNVVIEQEERRRRS----------FQDYTGQKITLEAVLNTTCKKCGCKGHFAK 144

  Fly    98 --FKKPDTKSFEKLRGQLREHKD------DTPSHTGGVSEKARERLREHIQRDRKRGPVSSTAAE 154
              |.:|....:..:..:..|.::      :.|..|...|.|.::..::...||||.....|:.:|
Mouse   145 DCFMQPGGTKYSLIPEEEEEKEEAKAEGLEKPDPTKNSSRKRKKEKKKKKHRDRKSSDCDSSDSE 209

  Fly   155 ---GRDRDRDWDRDRRRDRDRDRDRDRDRRQHRE 185
               |: :.|...:|.:..: :.:.:.:.:::|:|
Mouse   210 SDTGK-KARHSSKDSKATK-KKKKKKKHKKKHKE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0007NP_572947.1 DEXDc 529..715 CDD:214692
DEXDc 551..689 CDD:238005
HELICc 722..870 CDD:238034
HA2 932..1014 CDD:214852
OB_NTP_bind 1048..1148 CDD:285018
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.