DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)G0007 and Y108F1.5

DIOPT Version :9

Sequence 1:NP_572947.1 Gene:l(1)G0007 / 32373 FlyBaseID:FBgn0026713 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_001361911.1 Gene:Y108F1.5 / 353490 WormBaseID:WBGene00022433 Length:147 Species:Caenorhabditis elegans


Alignment Length:143 Identity:51/143 - (35%)
Similarity:87/143 - (60%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 ILNSLYQLWILGALDHTGALTT-LGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVPSI 985
            ::|.|..|:.|||:|.|..||: ||.|||||||.|...:.|:.:...||..|::.||:|:.:..:
 Worm     1 MINGLELLYALGAIDETSQLTSPLGLQMAEFPLPPMHSKCLLKSAEFGCFTEMVTIVAMMQIQDV 65

  Fly   986 FYRPKGREDEADGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQL 1050
            |..|..:..:||.:|:||...|.:|:|.|||:.::.:|..|..||::||::.:.:.:...||.||
 Worm    66 FITPYRQRHQADVIRKKFAVEEGNHITMLNVFTKFVENGRSKKWCSDHFVNYRGLMRADNVRSQL 130

  Fly  1051 KDIMTQQNLSVIS 1063
            ..::.:..:..:|
 Worm   131 VRLLKRFEIEKVS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)G0007NP_572947.1 DEXDc 529..715 CDD:214692
DEXDc 551..689 CDD:238005
HELICc 722..870 CDD:238034
HA2 932..1014 CDD:214852 34/82 (41%)
OB_NTP_bind 1048..1148 CDD:285018 3/16 (19%)
Y108F1.5NP_001361911.1 HrpA <1..>144 CDD:224557 51/143 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.