DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yl and Masp2

DIOPT Version :10

Sequence 1:NP_996433.1 Gene:yl / 32367 FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster
Sequence 2:NP_742040.1 Gene:Masp2 / 64459 RGDID:620214 Length:685 Species:Rattus norvegicus


Alignment Length:101 Identity:29/101 - (28%)
Similarity:46/101 - (45%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1418 DIDECQ----EQQPCAQLCENTLGGYQCQCHADFMLRQDRVSCKSLQSGATLLFSSFNEVRNLSE 1478
            |:|||:    :..||...|.|.||||.|.|...::|.|::.:|.:|.||.  :|:..:...:..|
  Rat   138 DVDECRTSLGDSVPCDHYCHNYLGGYYCSCRVGYILHQNKHTCSALCSGQ--VFTGRSGFLSSPE 200

  Fly  1479 QP------------VMLNVAWSANDSRITGFDLAMH 1502
            .|            :.|...:|.....:..||:.||
  Rat   201 YPQPYPKLSSCAYNIRLEEGFSITLDFVESFDVEMH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060
LDLa 184..216 CDD:238060
LDLa 227..262 CDD:238060
LDLa 271..302 CDD:238060
FXa_inhibition 352..387 CDD:464251
Ldl_recept_b 442..483 CDD:459654
LY 466..508 CDD:214531
Ldl_recept_b 529..569 CDD:459654
LY 553..595 CDD:214531
LY 596..637 CDD:214531
FXa_inhibition 669..700 CDD:464251
LY 774..815 CDD:214531
LDLa 1032..1062 CDD:238060
LDLa 1074..1109 CDD:238060
LDLa 1118..1152 CDD:238060
LDLa 1157..1189 CDD:197566
LDLa 1198..1232 CDD:238060
LDLa 1243..1279 CDD:238060
LDLa 1283..1318 CDD:238060
LDLa 1340..1371 CDD:197566
FXa_inhibition 1388..1416 CDD:464251
EGF_CA 1418..1452 CDD:214542 15/37 (41%)
Masp2NP_742040.1 CUB 19..136 CDD:238001
FXa_inhibition 152..180 CDD:464251 11/27 (41%)
CUB 184..295 CDD:238001 11/55 (20%)
Sushi 300..361 CDD:459664
Sushi 366..429 CDD:459664
Tryp_SPc 444..681 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.