DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yl and pwn

DIOPT Version :9

Sequence 1:NP_996433.1 Gene:yl / 32367 FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster
Sequence 2:NP_610267.2 Gene:pwn / 44011 FlyBaseID:FBgn0003174 Length:1363 Species:Drosophila melanogaster


Alignment Length:507 Identity:110/507 - (21%)
Similarity:162/507 - (31%) Gaps:196/507 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   958 PAAIMPYVP---------VATPNGIPLAASSP-VGQESHPCQQQNGGCSHICVGEGPYHSIC-LC 1011
            ||..:|.:|         ..|.:|   .||:| ||..|       ||      |.|...||. ..
  Fly   745 PATRLPQLPGSGSGSGSGSGTGSG---GASTPGVGVSS-------GG------GGGSGSSISPAA 793

  Fly  1012 PAGFVYRDAGNRTCVEALDCEFRCHS---GECLTMN-------HRCNG-----RRDCVDNSDEMN 1061
            ||..|.:.:|.....|....:.:.||   |...|.|       :|...     |.|.....|:..
  Fly   794 PANAVTQSSGGYVVPETEVVDLQGHSKPQGGAPTTNAGPTRPHYRQRPTQPPVRIDTCIVGDDST 858

  Fly  1062 CDE-EHRRKPKVLCSPNQ--FACHSGEQCVDKERRCDNRKDC---------------HDHS---- 1104
            ||: :|.|     |..:.  .:||    |.....|..:|:.|               ::|.    
  Fly   859 CDQAQHER-----CKTDNGVSSCH----CRPGYSRRKHREPCRRVISFHLGMRVDRIYEHRIVWD 914

  Fly  1105 ---DEQHCEKFDKSKKCHVHQHGCDNGKCVDSSLVCDGTNDCGDNSDELLCEA----TSRCEPGM 1162
               .::|.|.|.        |...::.:.:||::      .....|||.: ||    ..|.:|.:
  Fly   915 TKLMDKHSEPFG--------QLSYESIRALDSAM------SMTPYSDEFM-EAKVNNIYRGDPNL 964

  Fly  1163 FQCGSGSCIAGSWECDGRIDCSDGSDEHDKCVHRSCPPDMQRCLLGQCLDRSLVCDGHNDCGDKS 1227
              .|||.          .::.:...||..:.:..:...|:|:.|||....|      :|:.|   
  Fly   965 --GGSGV----------YVNMTIKLDESVETLRPNLRSDVQKHLLGVLHRR------NNNIG--- 1008

  Fly  1228 DELNCGTDSSTMNISCAEDQYQCTSNLKICLPSTVRCNGTTECPRGEDEADCGDVCSIYEFKCRS 1292
                    :|.:.:|..|.......:|..|           :.|...|              |.|
  Fly  1009 --------NSVLYVSSPEGAVSALQDLDEC-----------QSPELND--------------CHS 1040

  Fly  1293 GRECIRR--EFRCDGQKDCGDGSDELSCELEKGHHNQSQIQPWSTS-SRSCRPHLFDCQDGECVD 1354
            |..|...  .|||             :||       .....||:.. :||.|    :||  .|.|
  Fly  1041 GASCSNTWGSFRC-------------ACE-------AGLRDPWADQPARSGR----ECQ--ACAD 1079

  Fly  1355 LSRVCNNFPDCTNGHDEGPKCATACRSASGRQVCQHKCRATPAGAVCSCFDG 1406
              .||||...|:...|             |.|:|  .|.::..||.|. .||
  Fly  1080 --SVCNNHGTCSYAED-------------GAQLC--TCDSSHYGAQCE-IDG 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060
LDLa 184..216 CDD:238060
LDLa 227..262 CDD:238060
LDLa 271..302 CDD:238060
FXa_inhibition 352..387 CDD:291342
Ldl_recept_b 442..482 CDD:278487
LY 466..508 CDD:214531
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LY 596..637 CDD:214531
FXa_inhibition 669..700 CDD:291342
LY 774..815 CDD:214531
LDLa 1032..1062 CDD:238060 9/44 (20%)
LDLa 1074..1109 CDD:238060 8/58 (14%)
LDLa 1118..1152 CDD:238060 6/33 (18%)
LDLa 1157..1189 CDD:197566 5/31 (16%)
LDLa 1198..1232 CDD:238060 8/33 (24%)
LDLa 1243..1279 CDD:238060 5/35 (14%)
LDLa 1283..1318 CDD:238060 7/36 (19%)
LDLa 1340..1371 CDD:197566 10/30 (33%)
FXa_inhibition 1388..1416 CDD:291342 7/19 (37%)
EGF_CA 1418..1452 CDD:214542
pwnNP_610267.2 EGF_CA 1026..1075 CDD:214542 18/97 (19%)
EGF_2 1074..1109 CDD:285248 16/53 (30%)
Abhydrolase_9_N <1124..>1165 CDD:292062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24034
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.