DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yl and CG6553

DIOPT Version :9

Sequence 1:NP_996433.1 Gene:yl / 32367 FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:156 Identity:60/156 - (38%)
Similarity:77/156 - (49%) Gaps:35/156 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CPGGEDELNCPVRPGFRFGDTAHRMRSCSKYEFMCQQDRTCIPIDFMCDGRPDCTDKSDE-VAGC 220
            |.|.::..:|..|.|  .||                    ||.:|.:|||..:|.|.||| ||.|
  Fly    23 CLGSQNATSCGHRCG--GGD--------------------CIQLDQLCDGSANCLDGSDETVAMC 65

  Fly   221 KQAEITCPGEGHLCANGRCLRRKQWVCDGVDDCGDGSDERGCLNLCEPQKGKFLCRNRE------ 279
            :  ::.|||....|:.|.|:.... |||||.||.|||||:|.  ||..|..:..|.|.|      
  Fly    66 E--KVWCPGYAFRCSYGACIASTA-VCDGVQDCVDGSDEQGW--LCRAQMQQANCDNWEMYCSSG 125

  Fly   280 TCLTLSEVCDGHSDCSDGSDETD-LC 304
            .|:|.|::|||..||.||.||.: ||
  Fly   126 QCMTYSKLCDGIRDCRDGDDELESLC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060 2/8 (25%)
LDLa 184..216 CDD:238060 9/31 (29%)
LDLa 227..262 CDD:238060 18/34 (53%)
LDLa 271..302 CDD:238060 15/36 (42%)
FXa_inhibition 352..387 CDD:291342
Ldl_recept_b 442..482 CDD:278487
LY 466..508 CDD:214531
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LY 596..637 CDD:214531
FXa_inhibition 669..700 CDD:291342
LY 774..815 CDD:214531
LDLa 1032..1062 CDD:238060
LDLa 1074..1109 CDD:238060
LDLa 1118..1152 CDD:238060
LDLa 1157..1189 CDD:197566
LDLa 1198..1232 CDD:238060
LDLa 1243..1279 CDD:238060
LDLa 1283..1318 CDD:238060
LDLa 1340..1371 CDD:197566
FXa_inhibition 1388..1416 CDD:291342
EGF_CA 1418..1452 CDD:214542
CG6553NP_610911.1 LDLa 34..60 CDD:197566 13/47 (28%)
LDLa 70..101 CDD:197566 16/31 (52%)
LDLa 115..146 CDD:197566 13/30 (43%)
Frag1 <260..>303 CDD:287278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.