DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yl and Ldlrad3

DIOPT Version :9

Sequence 1:	NP_996433.1	Gene:	yl / 32367	FlyBaseID:	FBgn0004649	Length:	1984	Species:	Drosophila melanogaster
Sequence 2:	NP_849217.2	Gene:	Ldlrad3 / 241576	MGIID:	2138856	Length:	345	Species:	Mus musculus

Alignment Length:	132	Identity:	55/132 - (41%)
Similarity:	69/132 - (52%)	Gaps:	9/132 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly  1033 FRCHSGECLTMNHRCNGRRDCVDNSDEMNCDEEHRRKPKVLCSPNQFACHSGEQCVDKERRCDNR 1097
            |.|.:|.|:....:|:|..||.|.|||..|.     |.|..|.|..|.|.||..|:....||:..
Mouse    35 FMCSNGRCIPGAWQCDGLPDCFDKSDEKECP-----KAKSKCGPTFFPCASGIHCIIGRFRCNGF 94

  Fly  1098 KDCHDHSDEQHCEKFDKSKKCHVHQHGCDNGKCVDSSLVCDGTNDCGDNSDELLCEATSRCEPGM 1162
            :||.|.|||::|..  ....|...::.|.||.|:|.|.:|||.|:|.|||||..||  |..|||.
Mouse    95 EDCPDGSDEENCTA--NPLLCSTARYHCRNGLCIDKSFICDGQNNCQDNSDEESCE--SSLEPGS 155

  Fly  1163 FQ 1164
            .|
Mouse   156 GQ 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yl	NP_996433.1	LDLa	90..124	CDD:238060
		LDLa	131..166	CDD:238060
		LDLa	184..216	CDD:238060
		LDLa	227..262	CDD:238060
		LDLa	271..302	CDD:238060
		FXa_inhibition	352..387	CDD:291342
		Ldl_recept_b	442..482	CDD:278487
		LY	466..508	CDD:214531
		Ldl_recept_b	529..569	CDD:278487
		LY	553..595	CDD:214531
		LY	596..637	CDD:214531
		FXa_inhibition	669..700	CDD:291342
		LY	774..815	CDD:214531
		LDLa	1032..1062	CDD:238060	12/28 (43%)
		LDLa	1074..1109	CDD:238060	15/34 (44%)
		LDLa	1118..1152	CDD:238060	17/33 (52%)
		LDLa	1157..1189	CDD:197566	4/8 (50%)
		LDLa	1198..1232	CDD:238060
		LDLa	1243..1279	CDD:238060
		LDLa	1283..1318	CDD:238060
		LDLa	1340..1371	CDD:197566
		FXa_inhibition	1388..1416	CDD:291342
		EGF_CA	1418..1452	CDD:214542
Ldlrad3	NP_849217.2	LDLa	32..64	CDD:238060	12/28 (43%)
		LDLa	71..106	CDD:238060	15/34 (44%)
		LDLa	113..147	CDD:238060	17/33 (52%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	270..345
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900