Sequence 1: | NP_996433.1 | Gene: | yl / 32367 | FlyBaseID: | FBgn0004649 | Length: | 1984 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343649.1 | Gene: | M03E7.4 / 187424 | WormBaseID: | WBGene00019756 | Length: | 542 | Species: | Caenorhabditis elegans |
Alignment Length: | 330 | Identity: | 88/330 - (26%) |
---|---|---|---|
Similarity: | 121/330 - (36%) | Gaps: | 120/330 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 1127 NGKCVDSSLVCDG---TNDCGDNSDELLCEA--------------------------------TS 1156
Fly 1157 RCEPGMFQCGSGSCIAGSWECD-------------GRIDCSDGSDEHDKCVHRSCPPDMQRCLLG 1208
Fly 1209 QCLDRSLVCDGHNDCGDKSDELNCGTDSSTMNISCAEDQYQCTSNLKICLPSTVRCNGTTECPRG 1273
Fly 1274 EDEADCGDVCSIYEFKCRSGRECIRREFRCDGQKDCGDGSDELSC---ELEKGHHNQSQIQPWST 1335
Fly 1336 SSRSCRPHLFDCQDGEC-VDLSRVCNNFPDCTNGHDE-------GPKCATACRSASGRQVCQHKC 1392
Fly 1393 RATPA 1397 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yl | NP_996433.1 | LDLa | 90..124 | CDD:238060 | |
LDLa | 131..166 | CDD:238060 | |||
LDLa | 184..216 | CDD:238060 | |||
LDLa | 227..262 | CDD:238060 | |||
LDLa | 271..302 | CDD:238060 | |||
FXa_inhibition | 352..387 | CDD:291342 | |||
Ldl_recept_b | 442..482 | CDD:278487 | |||
LY | 466..508 | CDD:214531 | |||
Ldl_recept_b | 529..569 | CDD:278487 | |||
LY | 553..595 | CDD:214531 | |||
LY | 596..637 | CDD:214531 | |||
FXa_inhibition | 669..700 | CDD:291342 | |||
LY | 774..815 | CDD:214531 | |||
LDLa | 1032..1062 | CDD:238060 | |||
LDLa | 1074..1109 | CDD:238060 | |||
LDLa | 1118..1152 | CDD:238060 | 8/27 (30%) | ||
LDLa | 1157..1189 | CDD:197566 | 8/44 (18%) | ||
LDLa | 1198..1232 | CDD:238060 | 14/33 (42%) | ||
LDLa | 1243..1279 | CDD:238060 | 12/35 (34%) | ||
LDLa | 1283..1318 | CDD:238060 | 14/34 (41%) | ||
LDLa | 1340..1371 | CDD:197566 | 8/31 (26%) | ||
FXa_inhibition | 1388..1416 | CDD:291342 | 3/10 (30%) | ||
EGF_CA | 1418..1452 | CDD:214542 | |||
M03E7.4 | NP_001343649.1 | LDLa | 117..152 | CDD:238060 | 18/48 (38%) |
LDLa | 155..190 | CDD:238060 | 12/35 (34%) | ||
LDLa | 193..228 | CDD:238060 | 14/34 (41%) | ||
LDLa | 233..267 | CDD:238060 | 12/54 (22%) | ||
PHA03247 | <353..496 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |