DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and Pou2af1

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001103069.1 Gene:Pou2af1 / 690528 RGDID:1594728 Length:256 Species:Rattus norvegicus


Alignment Length:272 Identity:58/272 - (21%)
Similarity:85/272 - (31%) Gaps:91/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSGSYAAPAATYARRSHSVAAPSRQYLAPASSHGSYSSGGSSYAAPSVSHVSYSAPAASASASH- 105
            |:.|..|||.....:...|..|.::.|.....|.|..:.|               |.|:....| 
  Rat     6 STASEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGTAG---------------PPAAVVLPHQ 55

  Fly   106 --VSYS--APAAAHSSYAAPSVSHGSYSSASRTSYSAPVAAPSRKYLAPAAVSHSSYSAPVVSRK 166
              .:||  .|:......:||:|:......|...|..||..      |.|.               
  Rat    56 PLATYSTVGPSCLDMEVSAPTVTEEGTLCAGWLSQPAPAT------LQPL--------------- 99

  Fly   167 SYSAPAVSHGSYSSSGGSSGSYSAPVASYSSYSAPAASHTSYSAPVAAPSRQYLAPAASSYSAPA 231
                                   ||...|:.|    .||.:.|.|.:|.  .|:.|...||:...
  Rat   100 -----------------------APWTPYTEY----VSHEAVSCPYSAD--MYVQPVCPSYTVVG 135

  Fly   232 VSS---YSAPAV------SSYSAPAVS------SYSAPAVSHG-----SSYSTSSLSHGSYAAPS 276
            .||   |::|.:      .|.:.|||.      .:.||.....     |:..||||.: ...||:
  Rat   136 PSSVLTYASPPLITNVTPRSTATPAVGPQLEGPEHQAPLTYFPWPQPLSTLPTSSLQY-QPPAPT 199

  Fly   277 VSSKTYAAPAVS 288
            :|...:....:|
  Rat   200 LSGPQFVQLPIS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 27/138 (20%)
Pou2af1NP_001103069.1 PD-C2-AF1 7..255 CDD:286403 57/271 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.