DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and CG11350

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:471 Identity:145/471 - (30%)
Similarity:208/471 - (44%) Gaps:167/471 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAILILSLASVGLATPLSNTYLPPKVGA------------------------------QSGYSAA 38
            |...|.::|:.....| |:.||||..||                              :|.||.|
  Fly     6 FCAFIAAVAADVSHLP-SSQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPVESSYSVA 69

  Fly    39 ASSSSGSYAAPAATYARRSHSVAAPSRQYLAPASSHG-SYSSGGSSYAAPSVSH--------VSY 94
            ||:.:.||||||.:||..:.|.:||:..|.|.||:.. ||::...||:||:.::        |||
  Fly    70 ASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAASAPAVSY 134

  Fly    95 SAPAASASASHVSYSAPAAAHS-SYAAPSVSHGSYSSASRTSYSAP------------------- 139
            :|||.|.||...:|:|.|:|.: :||||:.::.:.:||...|||||                   
  Fly   135 AAPAQSYSAPAATYTAAASAPAVTYAAPAQTYTAAASAPAVSYSAPAESYETAASEPAHTFSAND 199

  Fly   140 -------------------------------VAAPSRKYL-----APAAVSHSSYSAPVVS---- 164
                                           .:||:.:||     |||.|..|:.|||.||    
  Fly   200 GYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAASAPAPVYQSAASAPAVSYAAP 264

  Fly   165 RKSYSAPAVSHGSYSSSGGSSGSYSAPVASY-SSYSAPAASHTS----------------YSAPV 212
            .::||||||             ||:.|..|| ::.||||.|.:|                :...|
  Fly   265 AQTYSAPAV-------------SYAEPAESYETAASAPAHSFSSNDGYRYKTHKRVVLRRHRRDV 316

  Fly   213 A-APSRQYLAPAASS----YSAPAVSSYSAPAVS----------SYSAPAVSSYSAPAVSHGSSY 262
            : .||..||.||||:    ||||| .||||||.:          ||:||| .||||||.::.::.
  Fly   317 SHLPSNDYLPPAASAPAPVYSAPA-QSYSAPAATYTAAASAPAVSYAAPA-QSYSAPAATYTAAA 379

  Fly   263 STSSLSHG----SYAAPSVSSKTYAAPAVSHGSYSGSSSGSGHGYGSGSSHGSGVRSGHGSSFGS 323
            |..::|:.    ||:||...|...:|||||:.:.:.|.|.....|.:.:|               
  Fly   380 SAPAVSYSAPSQSYSAPEYYSGAASAPAVSYSAPAASYSAPAESYETAAS--------------- 429

  Fly   324 GHKSGSYAANGGYEYR 339
             ..:.|:::|.||.|:
  Fly   430 -EPAHSFSSNDGYRYK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 66/214 (31%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 0/16 (0%)
GYR 296..313 CDD:128953 0/16 (0%)
GYR 438..455 CDD:128953 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.