DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and CG15022

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_647905.1 Gene:CG15022 / 38549 FlyBaseID:FBgn0035547 Length:295 Species:Drosophila melanogaster


Alignment Length:224 Identity:54/224 - (24%)
Similarity:65/224 - (29%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YLPPKVGAQSGYSAAASSSSGSYAAPAATYARRSHSVAAPSRQYLAPASSHGSYSSGGSSYAAPS 88
            ||||||          |........|.|||...|    .|..:||.|...        :.|..|.
  Fly   106 YLPPKV----------SLPPPPPPPPKATYLPPS----KPEVKYLPPEPV--------AKYLPPK 148

  Fly    89 VSHVSYSAPAASASASHVSYSAPAAAHSSYAAPSVSHGSYSSASRTSYSAPVAAPSRKYLAPAAV 153
            |:......|.....|...:|..|:...|.|..|                   ..|..|||.||.|
  Fly   149 VAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPP-------------------PTPEVKYLPPAPV 194

  Fly   154 SHSSYSAPVVSRKSYSAPAVSHGSYSSSGGSSGSYSAPVASYSSYSAPAASHTSYSAPVAAPSRQ 218
            :.  |..|.|:......|.                ..|||....|..||...|.| .|.:.|..:
  Fly   195 AR--YLPPKVAPSLPPPPP----------------PPPVAPKKLYLPPAEPETKY-LPPSEPVEK 240

  Fly   219 YLAPAASSYSAP---------AVSSYSAP 238
            ||.|.......|         .:.||:.|
  Fly   241 YLPPKPEQKYLPPQPEVDFHIPIPSYALP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 28/118 (24%)
CG15022NP_647905.1 PHA03247 <128..276 CDD:223021 43/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMGF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.