DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and Cpr56F

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:138 Identity:38/138 - (27%)
Similarity:59/138 - (42%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 ASHTSYSAPVAAPSRQYLAPAASSYSAPAVSSYSAPAVSSYSAPAVSSYSAPAVSHGSSYSTSSL 267
            |:.|....||  |..|||.|   :.|..|.|:...|....|.:|: |:|..|..:.|:..:.|: 
  Fly    14 AAWTHAEPPV--PQNQYLPP---NQSPQAPSNNYLPPTQGYQSPS-SNYLPPQRAGGNGGAPSN- 71

  Fly   268 SHGSYAAPSVSSK-TYAAPAVSHGSYSGSSSGSGHGYGSGSSHGSGVRSGHGSSFGSGHKSGSYA 331
               ||.||....: .|.|||::...:.|.:.....|||.|:.:|:|........:|...      
  Fly    72 ---SYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGPAK------ 127

  Fly   332 ANGGYEYR 339
                ||::
  Fly   128 ----YEFK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 17/50 (34%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.