DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and CG32564

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster


Alignment Length:318 Identity:121/318 - (38%)
Similarity:158/318 - (49%) Gaps:68/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GAQSGYSAAASS--SSGSYAAPAATYARRSHSVAAPSRQYLAPASSHGSYSSGGSSYAAPSVSHV 92
            |...|||::|||  |:.||:||:.:|     |..||:..|.|||.:        .||:||:.: |
  Fly   139 GNYGGYSSSASSSASANSYSAPSVSY-----SAPAPAVTYSAPAPA--------VSYSAPAPA-V 189

  Fly    93 SYSAPAASASASHVSYSAPAAAHSSYAAPSVSHGSYSSASRTSYSAPVAAPSRKYLAPAAVSHSS 157
            :||||   |.|..|:|||||......|||:|::.:.:.|...:||||..||:..|.|||      
  Fly   190 TYSAP---APAPAVTYSAPAPVVRVQAAPAVTYSAPAPAPAVTYSAPAPAPAVTYSAPA------ 245

  Fly   158 YSAPVVSRKSYSAPAVSHGSYSSSGGSSGSYSAPVASYSSYSAPAASHTSYSAPVAAPSRQYLAP 222
             .||||  :..:||||             :||||        |||   .:||||  ||:..|..|
  Fly   246 -PAPVV--RVQAAPAV-------------TYSAP--------APA---VTYSAP--APAVTYSGP 281

  Fly   223 A-ASSYSAPA---VSSYSAPAVSSYS-APAVSSYSAPAVSHGSSYSTSSLSHGSYAAPSVSSKTY 282
            | |.:|||||   |..|||||.:..| |||..|| ||.........|..|......||   ::.|
  Fly   282 APAVTYSAPAPVPVVRYSAPAPAPISYAPAPVSY-APQPQSQQVVKTIKLIVDEDRAP---AQVY 342

  Fly   283 AAPAV--SHGSYSGSSSGSGHGYGSGSSHGSGVRSGHGSSFGSGHKSG-SYAANGGYE 337
            ..|||  |:.|.|.|::.|..||..|  :..|...|:...:..|..|| |...|||::
  Fly   343 GPPAVESSYSSASSSAAASAGGYNGG--YNGGYNGGYNGGYNGGSNSGFSGGFNGGWK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 53/128 (41%)
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 83/201 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.