DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and CG32603

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster


Alignment Length:393 Identity:154/393 - (39%)
Similarity:209/393 - (53%) Gaps:103/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHSFAILILSLASVGLA--TPLSNTYLPPKVGAQS----GYSAA--ASSSSGSYAAPAA---TYA 54
            |..||||.|:|.:|..|  :.|:|||||||..|.|    .|.||  .:::|.:|.||||   ||.
  Fly     1 MKFFAILSLALLAVASADVSHLTNTYLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYE 65

  Fly    55 RRSHSVAA---PSRQYLAPASSHGSYSSG--------GSSYAAPSVSHVSYSAPAASASASHVSY 108
            ..|:|..|   .|..|.|||:...:..:.        .:||.||.|:..:|||||.|   |:.||
  Fly    66 SESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVS---SYSSY 127

  Fly   109 SAPAAAHSSYAAPSVSHGSYSSASRTSYSAP-VAAPSRKYLAPAAVSHSSYSAPVVSRKSYSAPA 172
            ||||....:|.||:|.. :||:.:.::|||| |:..|:.|.|||.|  .:||||.||  :|:||.
  Fly   128 SAPAVVAKTYTAPAVVK-TYSAPAVSTYSAPAVSGYSQTYTAPAVV--KTYSAPAVS--TYTAPV 187

  Fly   173 VSHGSYSSSGGSSGSYSAPVASYSSYSAPAASHTSYSAPVAAPS-------RQYLAPAASSYSAP 230
            |:.           :|:|||.: .:|:|||.|  :|:|||.|.:       :.|.|||.|:||||
  Fly   188 VTK-----------TYTAPVVA-KTYTAPAVS--TYTAPVVAKTYTAPAVVKTYSAPAVSTYSAP 238

  Fly   231 AVSSYSAPAVS-------------------SYSAPAVSSYSAPAVSH------GSSYSTSSLSHG 270
            |||:|:||.|:                   :|||||||:|:|||||.      ..:||..::|  
  Fly   239 AVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYSAPAVSTYTAPAVSTYTAPVVAKTYSAPAVS-- 301

  Fly   271 SYAAPSVSSKTYAAPAVSHGSYSGSSSGSGHGYGSGSSHGSGVRSGHGSSFGSGHKSGSYAANGG 335
            :|.|| |.:|||:|||||  |||..:..|.:...||:.:||                     |||
  Fly   302 TYTAP-VVTKTYSAPAVS--SYSAPAVVSSYSGSSGTVYGS---------------------NGG 342

  Fly   336 YEY 338
            |.|
  Fly   343 YVY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 59/150 (39%)
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 65/164 (40%)
rne <109..299 CDD:236766 87/211 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.