DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and Pou2af1

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_035266.1 Gene:Pou2af1 / 18985 MGIID:105086 Length:256 Species:Mus musculus


Alignment Length:237 Identity:58/237 - (24%)
Similarity:84/237 - (35%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSGSYAAPAATYARRSHSVAAPSRQYLAPASSHGSYSSGG--SSYAAPSVSHVSYSAPAAS---- 100
            |:....|||.....:...|..|.::.|.....|.|..:.|  ::...|.....:||....|    
Mouse     6 STAPEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGAAGPPTAVVLPHQPLATYSTVGPSCLDM 70

  Fly   101 -ASASHVS---------YSAPAAAHSSYAAP------SVSHGSYSSASRTS-YSAPVAAPSRKYL 148
             .|||.|:         .|.||.|.....||      .|||.:.|....|. |..|| .||...:
Mouse    71 EVSASTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEYVSHEAVSCPYSTDMYVQPV-CPSYTVV 134

  Fly   149 APAAVSHSSYSAPV----VSRKSYSAPAVS---HGSYSSSGGSSGSYSAPVASYSSYSAPAA--- 203
            .|::|  .:|::|.    |:.:|.:.|||.   .|.         .:.||: :|..:..|.:   
Mouse   135 GPSSV--LTYASPPLITNVTPRSTATPAVGPQLEGP---------EHQAPL-TYFPWPQPLSTLP 187

  Fly   204 -SHTSYSAPVAAPSRQYLAPAASSYSAPAVSSYSAP--AVSS 242
             |...|..|....|.........|...|.:.....|  |:||
Mouse   188 TSSLQYQPPAPTLSGPQFVQLPISIPEPVLQDMDDPRRAISS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 30/127 (24%)
Pou2af1NP_035266.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 4/17 (24%)
PD-C2-AF1 7..255 CDD:312716 57/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.