DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11585 and pou2af1

DIOPT Version :9

Sequence 1:NP_572943.2 Gene:CG11585 / 32365 FlyBaseID:FBgn0030543 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_009289855.1 Gene:pou2af1 / 103908823 -ID:- Length:248 Species:Danio rerio


Alignment Length:195 Identity:49/195 - (25%)
Similarity:68/195 - (34%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ARRSHSVAAPSRQY----LAPASSHGSYSSGGSSYAAPSVSHV--SYSAPAASASA----SHVSY 108
            ||.:.:|..||...    ||..|:.......|.:.:...||.:  .:.|...|.:|    ||  :
Zfish    35 ARSTATVMVPSNTLQSCTLAGTSTFAEVPQSGLNDSVVDVSGLCTGWIAQTTSTTALQPLSH--W 97

  Fly   109 SAPAAAHSSYAAPSVSHGS-YSSASRTSYSAPVAAPSRKYL-AP-----AAVSHSSYSAPVVSRK 166
            :.|...|...|.|  ||.. |.......|:...::|...:. ||     |.||.||...|.|...
Zfish    98 TPPDCQHHDPAIP--SHADMYVQPICPGYTVVGSSPMLTFAHAPLFTNLATVSTSSSVLPQVEVP 160

  Fly   167 SYSAPAVSHGSYSSSGGSSGSYSAPVASYSS-YSAPAASHTSYSAPVAAPSRQYLAPAASSYSAP 230
            ..|.      :|........:...||...|| .|||.......:.||.:|..:  .|......||
Zfish   161 DSSL------TYIPWAQPLSTIPGPVMQASSALSAPQLFPVPLTLPVLSPEPE--PPQVEPQQAP 217

  Fly   231  230
            Zfish   218  217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11585NP_572943.2 PRK12323 <130..>254 CDD:237057 26/108 (24%)
pou2af1XP_009289855.1 PD-C2-AF1 9..246 CDD:312716 49/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.