DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and SNAP91

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001229721.1 Gene:SNAP91 / 9892 HGNCID:14986 Length:907 Species:Homo sapiens


Alignment Length:725 Identity:167/725 - (23%)
Similarity:251/725 - (34%) Gaps:204/725 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QSFQQLVQTQLQQHIQSQIHPQVESIQASVPLASFTIQSSGQQQYQSAPAPAPAPVSIPA----- 97
            |:...|::| |:||:.                   |::.......:.:.||:|...|.||     
Human   269 QAPSSLMET-LEQHLN-------------------TLEGKKPGNNEGSGAPSPLSKSSPATTVTS 313

  Fly    98 ----PAPVVNSAP-------APAPAPVEVQQPAPQVIYEAPKPVIATQTAAKNAYLPPAP----- 146
                ||..::::|       |.|..||...:|:..::...| ...:...||..|..||.|     
Human   314 PNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQP-DFSSGGAAAAAAPAPPPPAGGAT 377

  Fly   147 ------------VQQFVPAPEPVVANIAPQQETITTTYNAPAAAPVPAPAPIAIPVPAVQEQHQV 199
                        ....||:...:....||:....|||.....|:   |.|.....|.||..:..:
Human   378 AWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATAS---ASASTTTTVTAVTAEVDL 439

  Fly   200 IQQTYSV-PAPAPAVQQSYSAPA-PAPVVQ--QTYSAPAPVVQEQTYTAAAPVQAVQQLTYSAPA 260
            ....::. |..|||..:..:||| |.||..  ...|...|....:....|||     :|...|..
Human   440 FGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAAP-----ELDLFAMK 499

  Fly   261 PVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTYSAPAPAP 325
            |...    |.|......:::.|.||.||       :||||:....:|...|.....|.:..:.|.
Human   500 PPET----SVPVVTPTASTAPPVPATAP-------SPAPAVAAAAAATTAATAAATTTTTTSAAT 553

  Fly   326 QQTYSAPAPAVQ------EQTQVVQSYSAPAPAPVAQ--QTYSYPAPVVQQAPVVQAVAQQAPVV 382
            ..|  || ||:.      |.|..|.:...|..||...  .|.::.:|....:||.::......:.
Human   554 ATT--AP-PALDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQGASPVPESSLTADLLS 615

  Fly   383 QQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQ-APVVQQSYSAPAPAPVVQQSYSAPAPVV 446
            ..:::||:||     |.::||.|     ..:.||.. ......|.|.|.||.....|.||.|.::
Human   616 VDAFAAPSPA-----TTASPAKV-----DSSGVIDLFGDAFGSSASEPQPASQAASSSSASADLL 670

  Fly   447 QETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVI-QQAPVVQQSYSA---PAPAPVVQQSYS 507
            ..             ...|:.||:|        :||. .|..::|.::.|   ..|:.....|:.
Human   671 AG-------------FGGSFMAPSP--------SPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFD 714

  Fly   508 -----------APAPAPVVQESIQQAPVIQQSYTAPAPVSI--PEP------------------- 540
                       .|..||..|               |||||:  |.|                   
Human   715 PSVFDGLGDLLMPTMAPAGQ---------------PAPVSMVPPSPAMAASKALGSDLDSSLASL 764

  Fly   541 ---------------VQQIVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPV------VISAPAPAP 584
                           :|....:.:.:|.:...|:.|||.....:|..||:      ..|.|..|.
Human   765 VGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAG 829

  Fly   585 APAPVQLQQSFVPAPPA----PIQIQQP---AQPIVQYSPPVVQQQVTYTQ--PAPAPIQVAAAA 640
            ||:..|....| ..|||    |:..|||   |||:::  ||.....|..||  |:|.|...:...
Human   830 APSVGQPGAGF-GMPPAGTGMPMMPQQPVMFAQPMMR--PPFGAAAVPGTQLSPSPTPASQSPKK 891

  Fly   641 PVAVSAPAEI 650
            |.|....|::
Human   892 PPAKDPLADL 901

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 55/209 (26%)
rne <329..539 CDD:236766 53/235 (23%)
TFIIA 475..>635 CDD:281188 52/225 (23%)
SNAP91NP_001229721.1 ANTH 21..284 CDD:311541 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..326 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..380 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..525 6/26 (23%)
Atrophin-1 <595..897 CDD:331285 80/350 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 867..907 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.