DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and Pou2af1

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001103069.1 Gene:Pou2af1 / 690528 RGDID:1594728 Length:256 Species:Rattus norvegicus


Alignment Length:287 Identity:71/287 - (24%)
Similarity:96/287 - (33%) Gaps:87/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TAAKNAYLPPAPVQQFVPAPEPVVANIAPQQETITTTYNAPAAAPVPAPAPIAIPVPAVQEQHQV 199
            ||::.|..||.|.|. |...|||       :|.:.......:......||.:.:|       ||.
  Rat     7 TASEQAPAPPRPYQG-VRVKEPV-------KELLRRKRGHTSVGTAGPPAAVVLP-------HQP 56

  Fly   200 IQQTYSVPAPAPAVQQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQLTYSAPAPVTQ 264
            : .|||...|: .:....|||.              |.:|.|..|.         ..|.|||.|.
  Rat    57 L-ATYSTVGPS-CLDMEVSAPT--------------VTEEGTLCAG---------WLSQPAPATL 96

  Fly   265 EQYYSAPASVVQQTSSAP-APAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTYSAPAPAPQQT 328
            :..             || .|....|..:..|.|       |||......|..:|:...|:...|
  Rat    97 QPL-------------APWTPYTEYVSHEAVSCP-------YSADMYVQPVCPSYTVVGPSSVLT 141

  Fly   329 YSAPAPAVQEQTQVVQSYSAPAPAP-------VAQQTY-SYPAPVVQQAPVVQAVAQQAPVVQQS 385
            |::| |.:...|.  :|.:.||..|       .|..|| .:|.|:           ...|.....
  Rat   142 YASP-PLITNVTP--RSTATPAVGPQLEGPEHQAPLTYFPWPQPL-----------STLPTSSLQ 192

  Fly   386 YSAPAPA----PVVQQTYSAPAPVVQE 408
            |..|||.    ..||...|.|.||:|:
  Rat   193 YQPPAPTLSGPQFVQLPISIPEPVLQD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 50/211 (24%)
rne <329..539 CDD:236766 25/92 (27%)
TFIIA 475..>635 CDD:281188
Pou2af1NP_001103069.1 PD-C2-AF1 7..255 CDD:286403 71/287 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15363
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.