DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and POU2AF1

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_005271650.1 Gene:POU2AF1 / 5450 HGNCID:9211 Length:303 Species:Homo sapiens


Alignment Length:335 Identity:90/335 - (26%)
Similarity:122/335 - (36%) Gaps:88/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LQQHIQSQIHPQVESIQASVPLASFTIQSSGQQQYQSAPAPAPAPVSIPAPAPVVNSAPAP--AP 110
            ||.|.:.  ||      .|..|:...:|:|........|.......|..:||..:..|.||  ||
Human     4 LQSHYEK--HP------PSYLLSWSQLQNSLAAGCGHVPGSQETRGSCGSPATSIGRATAPEQAP 60

  Fly   111 AP------VEVQQPAPQVIYEAPKPVIATQTAAKNAYLPPAPVQQFVPAPEPVVANIAPQQETIT 169
            ||      |.|::|..:::..  |...|:..||              |||..||   .|.|...|
Human    61 APARPYQGVRVKEPVKELLRR--KRGHASSGAA--------------PAPTAVV---LPHQPLAT 106

  Fly   170 TTYNAPAAAPVPAPAPIAIPVPAVQEQHQVIQQTYSVPAPAP----AVQQSYSAPAPAPVVQQTY 230
            .|...|:...:..      .|.||.|:..:.....|.|.||.    |....|:...|...|...|
Human   107 YTTVGPSCLDMEG------SVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPY 165

  Fly   231 SAP---APVVQEQTYTAAAPVQAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQ 292
            ||.   .||.  .:||...|...   |||::|..:|         :|..::|:.||..| |::..
Human   166 SADMYVQPVC--PSYTVVGPSSV---LTYASPPLIT---------NVTTRSSATPAVGP-PLEGP 215

  Fly   293 FYSAPAPAIQQTYSAPAPAPVVQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQ 357
            .:.||.     || .|.|.|:      :..|.....|..||||:            |.|..| |.
Human   216 EHQAPL-----TY-FPWPQPL------STLPTSTLQYQPPAPAL------------PGPQFV-QL 255

  Fly   358 TYSYPAPVVQ 367
            ..|.|.||:|
Human   256 PISIPEPVLQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 47/166 (28%)
rne <329..539 CDD:236766 14/39 (36%)
TFIIA 475..>635 CDD:281188
POU2AF1XP_005271650.1 PD-C2-AF1 54..302 CDD:286403 76/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.