DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG11350

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:632 Identity:201/632 - (31%)
Similarity:240/632 - (37%) Gaps:256/632 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKPFAFIVVAALSLVVVSGRPGAQYLPP------LPVKEVSA-AQSFQQLVQTQLQQHIQSQIHP 58
            ||.|.|....|.....||..|.:|||||      .||...|| :||:                  
  Fly     1 MKFFLFCAFIAAVAADVSHLPSSQYLPPGRGAASAPVASYSAPSQSY------------------ 47

  Fly    59 QVESIQASVPLASFTIQSSGQQQYQSAPAPAPAPVSIPAPAPVVNSAPAPAPAPVEVQQPAPQVI 123
               |::||.|:||::             ||..:..|:.|.||.|:.|   |||   |...||...
  Fly    48 ---SVEASAPVASYS-------------APVESSYSVAASAPAVSYA---APA---VSYAAPAQS 90

  Fly   124 YEAPKPVIATQTAAKNAYLPPAPVQQFVPAPEPVVANIAPQQETITTTYNAPAA---APVPAPAP 185
            |.||   .||.|||.:|               |.|:..||.|     :|:||||   |...||| 
  Fly    91 YSAP---AATYTAAASA---------------PAVSYAAPAQ-----SYSAPAATYTAAASAPA- 131

  Fly   186 IAIPVPAVQEQHQVIQQTYSVPAPAPAVQQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQA 250
            ::...||         |:||.||      .:|:|.|.||.|  ||:|||     |||||||...|
  Fly   132 VSYAAPA---------QSYSAPA------ATYTAAASAPAV--TYAAPA-----QTYTAAASAPA 174

  Fly   251 VQQLTYSAPAPVTQEQYYSAPASVVQQTSSA------------------------------PAPA 285
            |   :|||||     :.|...||....|.||                              ...|
  Fly   175 V---SYSAPA-----ESYETAASEPAHTFSANDGYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAA 231

  Fly   286 PAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTYSAPA---PAPQQTYSAPAPAVQEQTQVVQSYS 347
            .||..|  |..||        |.|||||.|...||||   .||.|||||||.:..|.   .:||.
  Fly   232 SAPTSE--YLPPA--------ASAPAPVYQSAASAPAVSYAAPAQTYSAPAVSYAEP---AESYE 283

  Fly   348 APAPAPV----AQQTYSYPAPV----------VQQAP----VVQAVAQQAPVVQQSYSAPAPAPV 394
            ..|.||.    :...|.|....          |...|    :..|.:..|||    |||||    
  Fly   284 TAASAPAHSFSSNDGYRYKTHKRVVLRRHRRDVSHLPSNDYLPPAASAPAPV----YSAPA---- 340

  Fly   395 VQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPVVQETIQQAPVIQQA 459
              |:|||||                    .:|:|.|.||.|  ||:|||                
  Fly   341 --QSYSAPA--------------------ATYTAAASAPAV--SYAAPA---------------- 365

  Fly   460 PVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAP------APAPVVQQSYSAPAPAPVVQES 518
                |||||||...........|...||  .||||||      |.||.|  ||||||        
  Fly   366 ----QSYSAPAATYTAAASAPAVSYSAP--SQSYSAPEYYSGAASAPAV--SYSAPA-------- 414

  Fly   519 IQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYS-----GYSYQTPQQ 560
                    .||:|||     |..:....:|.:|     ||.|:|.::
  Fly   415 --------ASYSAPA-----ESYETAASEPAHSFSSNDGYRYKTQRR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 83/249 (33%)
rne <329..539 CDD:236766 72/233 (31%)
TFIIA 475..>635 CDD:281188 31/97 (32%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 0/16 (0%)
GYR 296..313 CDD:128953 2/16 (13%)
GYR 438..455 CDD:128953 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.