DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG34205

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster


Alignment Length:268 Identity:88/268 - (32%)
Similarity:129/268 - (48%) Gaps:76/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 TYSAPAP-VTQEQYYSAPASVVQQTSSAPAPAPAP-VQEQFYSAP-------APAIQQTYSAPAP 310
            |||..:| ...:...||...::..||.......|| :.:..:|||       ||||  ||:|.||
  Fly     5 TYSCNSPSKPSDSLSSASMKLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAI--TYAAAAP 67

  Fly   311 APVVQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAV 375
               |.::|:|||    .||:||||       |::||:|||      .:|::.||         |:
  Fly    68 ---VIKSYAAPA----ITYAAPAP-------VIKSYAAPA------ISYAHAAP---------AI 103

  Fly   376 AQQAPVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYS 440
            :..||.|.:||:||....|     :|||......   :.|:..|..:.:||:|||.|      |:
  Fly   104 SYAAPTVVKSYAAPVAVKV-----AAPATSYSHF---SSVVSHATPIVKSYAAPAIA------YA 154

  Fly   441 APAPVVQETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPA---PAPVV 502
            |||||::.        ..||.:..:::|||           :...||.|.:||:|||   .||.:
  Fly   155 APAPVIKS--------YAAPAISYAHAAPA-----------ISYAAPTVVKSYAAPAISYAAPAL 200

  Fly   503 QQSYSAPA 510
            .:||:|||
  Fly   201 VKSYAAPA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 54/161 (34%)
rne <329..539 CDD:236766 60/185 (32%)
TFIIA 475..>635 CDD:281188 15/39 (38%)
CG34205NP_001097407.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.