DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG32564

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster


Alignment Length:472 Identity:150/472 - (31%)
Similarity:182/472 - (38%) Gaps:223/472 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 QVIQQTYSVPAPAPAVQQS---------YSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQ 253
            |||:....|..|:.:..:|         ||:.|.:.....:||||:                   
  Fly   116 QVIKVIKVVEQPSYSYGRSSGYGGNYGGYSSSASSSASANSYSAPS------------------- 161

  Fly   254 LTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTY 318
            ::||||||...                             |||||||:  :|||||||    .||
  Fly   162 VSYSAPAPAVT-----------------------------YSAPAPAV--SYSAPAPA----VTY 191

  Fly   319 SAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQ 383
            |||||||..|||||||.|:.|.....:||||||||..  |||.|||              ||.| 
  Fly   192 SAPAPAPAVTYSAPAPVVRVQAAPAVTYSAPAPAPAV--TYSAPAP--------------APAV- 239

  Fly   384 QSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPVVQE 448
             :||||||||||:                   :|.||.|  :|||||||    .:||||||.|  
  Fly   240 -TYSAPAPAPVVR-------------------VQAAPAV--TYSAPAPA----VTYSAPAPAV-- 276

  Fly   449 TIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPAP 513
                            :||.|||.|                  :||||||.|||:  ||||||||
  Fly   277 ----------------TYSGPAPAV------------------TYSAPAPVPVVR--YSAPAPAP 305

  Fly   514 VVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPVVIS 578
            :             || ||||||                       .||.|..|.:         
  Fly   306 I-------------SY-APAPVS-----------------------YAPQPQSQQV--------- 324

  Fly   579 APAPAPAPAPVQLQQSFVPAPPAPIQIQQPAQPIVQYSPPVVQQQVTYTQPAPAPIQVAAAAPVA 643
                      |:..:..|....||.|:         |.||.|:...:           :|::..|
  Fly   325 ----------VKTIKLIVDEDRAPAQV---------YGPPAVESSYS-----------SASSSAA 359

  Fly   644 VSAPAEIGTNYAANGGY 660
            .||.   |.|...||||
  Fly   360 ASAG---GYNGGYNGGY 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 74/207 (36%)
rne <329..539 CDD:236766 84/209 (40%)
TFIIA 475..>635 CDD:281188 38/159 (24%)
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 115/306 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.