DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG2962

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_572612.2 Gene:CG2962 / 31952 FlyBaseID:FBgn0030186 Length:376 Species:Drosophila melanogaster


Alignment Length:432 Identity:141/432 - (32%)
Similarity:180/432 - (41%) Gaps:155/432 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QASVPLASFTIQSSGQQQYQSAP----------------APAPAPVSIPAPAPVVNSAPAPAPAP 112
            |..|..:|.....|| ..|::||                .|||.|..:| ||       .|||:.
  Fly    72 QGGVGYSSGASYGSG-YGYEAAPQIFKVKVISGGSGGGYGPAPGPAYLP-PA-------GPAPSS 127

  Fly   113 VEVQQPAPQVIYEAPKPVIATQTAAKNAYLPPAPVQQFVPAPEPV-VANIAPQQETITTTYNAPA 176
            |:|.:     |.:...|:::            ||:.:  .||:.| |.|:              |
  Fly   128 VKVIK-----ILQESAPIVS------------APLVE--SAPQIVKVVNV--------------A 159

  Fly   177 AAPVPAPAPI---AIPVPAVQEQHQVIQQTYSVPAPAPAVQQ------SYSAPAPAPVVQQTYSA 232
            :.||..|:.|   ::...||.:..:|:.:::.....:.....      .||:.....||:     
  Fly   160 SGPVAGPSFIGGSSVGGGAVSQVIKVVHESHDSGISSGGYSSGGYSSGGYSSGGATKVVR----- 219

  Fly   233 PAPVVQEQTYTAAAPVQAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAP 297
               |:.|.:..||.|..|    ....||||      :||.:.........||||.      |:||
  Fly   220 ---VIHEHSAPAAGPAYA----PIDVPAPV------AAPVASYLPPQEIAAPAPV------YAAP 265

  Fly   298 APAIQQTYSAPAPAPVVQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYP 362
            |||  ..|:|||||||    ||||||||  .|||||||        ..|||||||||    ||.|
  Fly   266 APA--PVYAAPAPAPV----YSAPAPAP--VYSAPAPA--------PVYSAPAPAPV----YSAP 310

  Fly   363 APVVQQAPVVQAVAQQAPVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYS 427
            ||              ||    :|||||||||    ||||||              |||    |:
  Fly   311 AP--------------AP----AYSAPAPAPV----YSAPAP--------------APV----YA 335

  Fly   428 APAPAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAP 469
            |||||||:...:.|||||.....|..| |..||.  |:|..|
  Fly   336 APAPAPVLSVPHPAPAPVFAPEEQSLP-IGHAPA--QTYGPP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 80/204 (39%)
rne <329..539 CDD:236766 62/141 (44%)
TFIIA 475..>635 CDD:281188
CG2962NP_572612.2 DUF4766 57..189 CDD:292595 37/158 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.