DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG31626

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:440 Identity:179/440 - (40%)
Similarity:195/440 - (44%) Gaps:194/440 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YEAPKPVIATQTAAKNAYLPPAPVQQFV--PAPEPVVANIAPQQETITTTYNAPAAAPV---PAP 183
            |..|.|.....:|...||||  |||:.:  |||.||.:..||     ...|:|||.|||   |||
  Fly    29 YNKPTPTFNIPSAPAPAYLP--PVQEVISAPAPAPVYSAPAP-----APVYSAPAPAPVYSAPAP 86

  Fly   184 APIAIPVPAVQEQHQVIQQTYSVPAPAPAVQQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPV 248
            ||::..:|.||:          :|||||.    |||||||||    ||||||          |||
  Fly    87 APVSEYLPPVQD----------IPAPAPV----YSAPAPAPV----YSAPAP----------APV 123

  Fly   249 QAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPV 313
                   ||||||..:   |..|...:      ||||||||    |||||||  ..|||||||||
  Fly   124 -------YSAPAPAPE---YLPPVQDI------PAPAPAPV----YSAPAPA--PVYSAPAPAPV 166

  Fly   314 VQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQ 378
                ||||||||...|   .|.||:         .||||||    ||.|||              
  Fly   167 ----YSAPAPAPVSEY---LPPVQD---------IPAPAPV----YSAPAP-------------- 197

  Fly   379 APVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPA 443
            |||    |||||||||    ||||||..    :..|.:|..|       |||||||    |||||
  Fly   198 APV----YSAPAPAPV----YSAPAPAP----EYLPPVQDLP-------APAPAPV----YSAPA 239

  Fly   444 PVVQETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSA 508
            |                       |||||                    |||||||||    |||
  Fly   240 P-----------------------APAPV--------------------YSAPAPAPV----YSA 257

  Fly   509 PAPAPVVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTP 558
            ||||||              |:|||||.              |||.|..|
  Fly   258 PAPAPV--------------YSAPAPVE--------------SGYQYNVP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 94/198 (47%)
rne <329..539 CDD:236766 78/209 (37%)
TFIIA 475..>635 CDD:281188 29/84 (35%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 125/279 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.