DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG31626

DIOPT Version :10

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:440 Identity:179/440 - (40%)
Similarity:195/440 - (44%) Gaps:194/440 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YEAPKPVIATQTAAKNAYLPPAPVQQFV--PAPEPVVANIAPQQETITTTYNAPAAAPV---PAP 183
            |..|.|.....:|...||||  |||:.:  |||.||.:..||     ...|:|||.|||   |||
  Fly    29 YNKPTPTFNIPSAPAPAYLP--PVQEVISAPAPAPVYSAPAP-----APVYSAPAPAPVYSAPAP 86

  Fly   184 APIAIPVPAVQEQHQVIQQTYSVPAPAPAVQQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPV 248
            ||::..:|.||:          :|||||.    |||||||||    ||||||          |||
  Fly    87 APVSEYLPPVQD----------IPAPAPV----YSAPAPAPV----YSAPAP----------APV 123

  Fly   249 QAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPV 313
                   ||||||..:   |..|...:      ||||||||    |||||||  ..|||||||||
  Fly   124 -------YSAPAPAPE---YLPPVQDI------PAPAPAPV----YSAPAPA--PVYSAPAPAPV 166

  Fly   314 VQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQ 378
                ||||||||...|   .|.||:         .||||||    ||.|||              
  Fly   167 ----YSAPAPAPVSEY---LPPVQD---------IPAPAPV----YSAPAP-------------- 197

  Fly   379 APVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPA 443
            |||    |||||||||    ||||||..    :..|.:|..|       |||||||    |||||
  Fly   198 APV----YSAPAPAPV----YSAPAPAP----EYLPPVQDLP-------APAPAPV----YSAPA 239

  Fly   444 PVVQETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSA 508
            |                       |||||                    |||||||||    |||
  Fly   240 P-----------------------APAPV--------------------YSAPAPAPV----YSA 257

  Fly   509 PAPAPVVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTP 558
            ||||||              |:|||||.              |||.|..|
  Fly   258 PAPAPV--------------YSAPAPVE--------------SGYQYNVP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 PHA03247 <208..634 CDD:223021 145/351 (41%)
rne <329..539 CDD:236766 78/209 (37%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:481241 125/279 (45%)

Return to query results.
Submit another query.