DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and CG32603

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster


Alignment Length:433 Identity:159/433 - (36%)
Similarity:205/433 - (47%) Gaps:140/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NAYLPPAPVQQFVPAPEPVVANIAPQQETITTTYNAPAAAPVPAPAPIAIPVPAVQEQHQVIQQT 203
            |.|||                   |:....:|:|.:..||||.|.|                .:|
  Fly    24 NTYLP-------------------PKSAAASTSYESYQAAPVEAAA----------------SET 53

  Fly   204 YSVPAPAPAV--QQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQLTYSAPAPVTQEQ 266
            |..||.|.:.  .:|||||| |....::|:||| .|:....|||.  :..:|...|..|||..:.
  Fly    54 YVAPAAAASTYESESYSAPA-ASFTSESYAAPA-AVEAAVETAAE--ETNEQPAASYVAPVVTKT 114

  Fly   267 YYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTYSAPAPAP-QQTYS 330
            .|||||  |...||..|||   |..:.|:  |||:.:||||||.:     ||||||.:. .|||:
  Fly   115 TYSAPA--VSSYSSYSAPA---VVAKTYT--APAVVKTYSAPAVS-----TYSAPAVSGYSQTYT 167

  Fly   331 APAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQQSYSAPA----P 391
            |||        ||::|||||.:       :|.||||.:       ...||||.::|:|||    .
  Fly   168 APA--------VVKTYSAPAVS-------TYTAPVVTK-------TYTAPVVAKTYTAPAVSTYT 210

  Fly   392 APVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPA----PAPVVQQSYSAPAPVVQETIQQ 452
            ||||.:||:|||.|         ....||.| .:|||||    .||||.::|:  ||||.:|   
  Fly   211 APVVAKTYTAPAVV---------KTYSAPAV-STYSAPAVSTYTAPVVTKTYT--APVVTKT--- 260

  Fly   453 APVIQQAPVVQQSYSAPAPVVQETIQQAPVIQ--QAPVVQQSYSAPA----PAPVVQQSYSAPAP 511
                ..||.|.::|||||    .:...||.:.  .||||.::|||||    .||||.::|||||.
  Fly   261 ----YTAPAVVKTYSAPA----VSTYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAV 317

  Fly   512 APVVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYS 554
            :               ||:|||.||            .|||.|
  Fly   318 S---------------SYSAPAVVS------------SYSGSS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 85/205 (41%)
rne <329..539 CDD:236766 87/223 (39%)
TFIIA 475..>635 CDD:281188 31/86 (36%)
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 76/203 (37%)
rne <109..299 CDD:236766 101/246 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.