DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11584 and Pou2af1

DIOPT Version :9

Sequence 1:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_035266.1 Gene:Pou2af1 / 18985 MGIID:105086 Length:256 Species:Mus musculus


Alignment Length:293 Identity:66/293 - (22%)
Similarity:97/293 - (33%) Gaps:92/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 QTSSAPAPAPAPVQE-QFYSAPAPAIQ---------QTYSAPAPAPVV-----QQTYSAPAPAPQ 326
            |.|:||..||||.:. |......|..:         ...:|..|..||     ..|||...|:..
Mouse     4 QKSTAPEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGAAGPPTAVVLPHQPLATYSTVGPSCL 68

  Fly   327 QTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQQSYSAPAP 391
            ....:.:...:|.|......|.||||.:        .|:....|..:.|:.:|          ..
Mouse    69 DMEVSASTVTEEGTLCAGWLSQPAPATL--------QPLAPWTPYTEYVSHEA----------VS 115

  Fly   392 APVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPAPVVQETIQQAPVI 456
            .|.....|..|                   |..||:...|:.|:  :|::|           |:|
Mouse   116 CPYSTDMYVQP-------------------VCPSYTVVGPSSVL--TYASP-----------PLI 148

  Fly   457 QQAPVVQQSYSAPA--PVVQETIQQAPVIQQAPVVQQSYSAPAP---APVVQQSYSAPAPAPVVQ 516
            ..  |..:|.:.||  |.::....|||:..        :..|.|   .|.....|..|||.....
Mouse   149 TN--VTPRSTATPAVGPQLEGPEHQAPLTY--------FPWPQPLSTLPTSSLQYQPPAPTLSGP 203

  Fly   517 ESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQ 549
            :.:|            .|:||||||.|.:..|:
Mouse   204 QFVQ------------LPISIPEPVLQDMDDPR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11584NP_572941.1 rne <209..408 CDD:236766 32/145 (22%)
rne <329..539 CDD:236766 42/214 (20%)
TFIIA 475..>635 CDD:281188 20/78 (26%)
Pou2af1NP_035266.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 9/19 (47%)
PD-C2-AF1 7..255 CDD:312716 64/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.