DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1368 and Pou2af1

DIOPT Version :9

Sequence 1:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001103069.1 Gene:Pou2af1 / 690528 RGDID:1594728 Length:256 Species:Rattus norvegicus


Alignment Length:201 Identity:43/201 - (21%)
Similarity:69/201 - (34%) Gaps:62/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVSYSAPAVQQTYAAPAIQQ----------------SYVAPSNEYLP--PVQTYSA---PAVQRT 79
            :.|..|||..:.|....:::                :...|:...||  |:.|||.   ..:...
  Rat     7 TASEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGTAGPPAAVVLPHQPLATYSTVGPSCLDME 71

  Fly    80 YSAPAVQR---------TYSAPS--------------VSYSAPSVSYSA--------PSVSYSAP 113
            .|||.|..         :..||:              ||:.|.|..|||        ||.:...|
  Rat    72 VSAPTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEYVSHEAVSCPYSADMYVQPVCPSYTVVGP 136

  Fly   114 AVQQSYSAPSV-------SYSAPAVQQSYSAPSVSYSAPAVQQSYSAPAVSYSAPSVSYSAPSVD 171
            :...:|::|.:       |.:.|||......|  .:.||.....:..|..:....|:.|..|:..
  Rat   137 SSVLTYASPPLITNVTPRSTATPAVGPQLEGP--EHQAPLTYFPWPQPLSTLPTSSLQYQPPAPT 199

  Fly   172 V-GTQY 176
            : |.|:
  Rat   200 LSGPQF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 41/192 (21%)
Pou2af1NP_001103069.1 PD-C2-AF1 7..255 CDD:286403 43/201 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.