DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1368 and CG11350

DIOPT Version :9

Sequence 1:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:219 Identity:102/219 - (46%)
Similarity:136/219 - (62%) Gaps:49/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIAFALFACVAADVSHL-SNEYLPPVQSSYAAPSVSYSAPA-----------------VQQT 47
            |||.:..|..|.|||||||| |::||||.:.:.:||..|||||:                 |:.:
  Fly     1 MKFFLFCAFIAAVAADVSHLPSSQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPVESS 65

  Fly    48 Y----AAPAIQQSYVAPSNEYLPPVQTYSAPAVQRTY----SAPAVQRTYSAPSVSYSAPSVSY- 103
            |    :|||:  ||.||:..|..|.|:|||||.  ||    |||||  :|:||:.|||||:.:| 
  Fly    66 YSVAASAPAV--SYAAPAVSYAAPAQSYSAPAA--TYTAAASAPAV--SYAAPAQSYSAPAATYT 124

  Fly   104 ---SAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSY----SAPAVSYSAP 161
               |||:|||:|||  ||||||:.:|:|.|     |||:|:|:|||  |:|    ||||||||||
  Fly   125 AAASAPAVSYAAPA--QSYSAPAATYTAAA-----SAPAVTYAAPA--QTYTAAASAPAVSYSAP 180

  Fly   162 SVSYSAPSVDVGTQYASNGGYVYR 185
            :.||...:.:....:::|.||.|:
  Fly   181 AESYETAASEPAHTFSANDGYRYK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 93/190 (49%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 4/7 (57%)
GYR 296..313 CDD:128953
GYR 438..455 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.