DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1368 and CG31626

DIOPT Version :9

Sequence 1:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:273 Identity:97/273 - (35%)
Similarity:118/273 - (43%) Gaps:99/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIAFALFACVAADVSHLS-------NE--------------YLPPVQS--SYAAPSVSYSAPAV 44
            |:.|....|..:||||||:       |:              ||||||.  |..||:..|||||.
  Fly     4 FVFAVCAIALASADVSHLNLGSGYSYNKPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSAPAP 68

  Fly    45 QQTYAAPAIQQSYVAPS----NEYLPPVQ-------TYSAPAVQRTYSAPAVQRTYSAPS----- 93
            ...|:|||....|.||:    :|||||||       .|||||....|||||....||||:     
  Fly    69 APVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPEY 133

  Fly    94 ------VSYSAPSVSYSAPSVS--YSAPAVQQSYSAPSVS------------------YSAPAVQ 132
                  :...||:..||||:.:  |||||....||||:.:                  |||||..
  Fly   134 LPPVQDIPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPA 198

  Fly   133 QSYSAPSVS--YSAPAVQQSY-----------------------------SAPAVSYSAPSVS-- 164
            ..||||:.:  |||||....|                             .|||..||||:.:  
  Fly   199 PVYSAPAPAPVYSAPAPAPEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPAPVYSAPAPAPV 263

  Fly   165 YSAPS-VDVGTQY 176
            ||||: |:.|.||
  Fly   264 YSAPAPVESGYQY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 90/255 (35%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 72/176 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.