DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1368 and CG32603

DIOPT Version :9

Sequence 1:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster


Alignment Length:345 Identity:119/345 - (34%)
Similarity:155/345 - (44%) Gaps:161/345 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKF--LIAFALFACVAADVSHLSNEYLPPVQ---------------------------------- 29
            |||  :::.||.|..:||||||:|.||||..                                  
  Fly     1 MKFFAILSLALLAVASADVSHLTNTYLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYE 65

  Fly    30 -----------------------------------------------------------SSYAAP 35
                                                                       |||:||
  Fly    66 SESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAP 130

  Fly    36 SV---SYSAPAVQQTYAAPAI-----------QQSYVAPS--NEY-LPPVQTYSAPAVQRTYSAP 83
            :|   :|:||||.:||:|||:           .|:|.||:  ..| .|.|.||:||.|.:||:||
  Fly   131 AVVAKTYTAPAVVKTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAP 195

  Fly    84 AVQRTYSAPSVS-------------------YSAPSVS-YSAPSVS-YSAPAVQQSYSAPSV--S 125
            .|.:||:||:||                   ||||:|| ||||:|| |:||.|.::|:||.|  :
  Fly   196 VVAKTYTAPAVSTYTAPVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTYTAPVVTKT 260

  Fly   126 YSAPAVQQSYSAPSVS---------YSAPAVQQSYSAPAVS----------YSAPSV-SYSAPSV 170
            |:||||.::||||:||         |:||.|.::|||||||          ||||:| |||||:|
  Fly   261 YTAPAVVKTYSAPAVSTYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAVSSYSAPAV 325

  Fly   171 ------DVGTQYASNGGYVY 184
                  ..||.|.|||||||
  Fly   326 VSSYSGSSGTVYGSNGGYVY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 102/309 (33%)
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 26/156 (17%)
rne <109..299 CDD:236766 77/189 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.