DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1368 and pou2af1

DIOPT Version :9

Sequence 1:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_009289855.1 Gene:pou2af1 / 103908823 -ID:- Length:248 Species:Danio rerio


Alignment Length:174 Identity:39/174 - (22%)
Similarity:62/174 - (35%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DVSHLSNEYLPPVQSSYAAPSVSYSAPAVQQTY--AAPAIQQSYVAPSNEYLPPVQTYSAPAVQR 78
            |||.|...::....|:.|...:|:..|...|.:  |.|:....||.|    :.|..|....:...
Zfish    73 DVSGLCTGWIAQTTSTTALQPLSHWTPPDCQHHDPAIPSHADMYVQP----ICPGYTVVGSSPML 133

  Fly    79 TYS-APAVQRTYSAPSVSYSAPSVSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYSAPSVSY 142
            |:: ||......:..:.|...|.|.....|::|.      .::.|..:...|.:|.|        
Zfish   134 TFAHAPLFTNLATVSTSSSVLPQVEVPDSSLTYI------PWAQPLSTIPGPVMQAS-------- 184

  Fly   143 SAPAVQQSYSAPAVSYSAPSVSYSAPSVDVGTQYASNGGYVYRK 186
            ||.:..|.:..|   .:.|.:|.......|..|.|..|.....|
Zfish   185 SALSAPQLFPVP---LTLPVLSPEPEPPQVEPQQAPEGTLALEK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 34/156 (22%)
pou2af1XP_009289855.1 PD-C2-AF1 9..246 CDD:312716 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.