DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes1 and bic

DIOPT Version :9

Sequence 1:NP_572938.2 Gene:betaNACtes1 / 32360 FlyBaseID:FBgn0030538 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_476853.1 Gene:bic / 45827 FlyBaseID:FBgn0000181 Length:169 Species:Drosophila melanogaster


Alignment Length:165 Identity:45/165 - (27%)
Similarity:73/165 - (44%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKKLKKMEEVVRIGGKGSMRRKHKRFPSSAAA-EKRVQATLAMLPLKNIDEIEEVTIEFTNSS 64
            |:.:||||::..|||||||:.|||.|...|:.|. :|::|::|..|.:..|..||||.|...:.:
  Fly     1 MNAEKLKKLQAQVRIGGKGTPRRKKKIVHSTPATDDKKLQSSLKKLSVNTIPGIEEVNIIKNDGT 65

  Fly    65 KVVLTMPRVQSTAGNSFFVVSGDFVRKSST------------------------------AGPSK 99
            .:....|:.|::...:.|.::|....|:.|                              ||.:.
  Fly    66 VIHFNNPKAQASLPTNTFAITGHGENKTITEMVPGILTQLGPQDINQLKKLATEIASKSGAGGAA 130

  Fly   100 VAKAANAPKAPMPPKPPKPE--AFSDKKPESEESI 132
            .:.||:|....:|......|  |.:|.|.|....:
  Fly   131 GSSAADAGDDDVPDLVENFEEVAIADTKEEKSGEV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes1NP_572938.2 NAC 37..90 CDD:280093 13/52 (25%)
bicNP_476853.1 NAC 38..90 CDD:280093 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.