DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ben and Ube2n

DIOPT Version :9

Sequence 1:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006514407.1 Gene:Ube2n / 93765 MGIID:1934835 Length:171 Species:Mus musculus


Alignment Length:142 Identity:113/142 - (79%)
Similarity:129/142 - (90%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITK 74
            :|||||:.||||||.|.|||:|||||||::.||.|||||||.|||||||||:|||:||||||:||
Mouse    29 QETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTK 93

  Fly    75 IYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRN 139
            |||||:|:|||||||:|||||||||||||:|||||||||||||||||||||||.||.|||:||..
Mouse    94 IYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIET 158

  Fly   140 AREWTQKYAVED 151
            ||.||:.||:.:
Mouse   159 ARAWTRLYAMNN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
benNP_001162752.1 UBCc 3..149 CDD:412187 112/138 (81%)
Ube2nXP_006514407.1 UBCc 29..170 CDD:381827 113/140 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836724
Domainoid 1 1.000 244 1.000 Domainoid score I2193
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3075
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - oto94026
orthoMCL 1 0.900 - - OOG6_101934
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1581
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.